Navigation Links


Tumor in Medical News

Delays in UK child brain tumor diagnosis

Significant numbers of children in the UK are suffering from preventable levels of disability, particularly blindness, and premature death because of poor diagnosis of brain tumours. A new study by scientists at The University of Nottingham's Children's Brain Tumour Research Centre, funded by t...

Amgen and Wyeth Statement on FDA Announcement About Tumor Necrosis Factor (TNF) Blockers

THOUSAND OAKS, Calif. and COLLEGEVILLE, Pa., Aug. 4 /PRNewswire-FirstCall/ -- Amgen (Nasdaq: AMGN ) and Wyeth Pharmaceuticals, a division of Wyeth (NYSE: WYE ), issued a statement in response to the Food and Drug Administration (FDA) announcement regarding the results of a safety rev...

'Suicide' Genes Help Slow Ovarian Tumor Growth in Mice

Treatment could be tested in women within 18 to 24 months, expert suggests THURSDAY, July 30 (HealthDay News) -- Treatment with "suicide" genes slowed ovarian tumor growth in mice and may one day offer a way to treat late-stage ovarian cancer in women, U.S. scientists say. Currently...

Nanoparticle-delivered 'Suicide' Genes Slowed Ovarian Tumor Growth

Potential late-stage ovarian cancer therapy; currently none available; Diphtheria-encoding genes delivered to tumor site by nanoparticles; Laboratory research; possible human trials about 18 months away Philadelphia (Vocus) July 29, 2009 -- Nanoparticle delivery of diph...

Grant for brain tumor and deafness research

Researchers at the Peninsula Medical School have received a grant of over 39,000 from the charity Deafness Research UK, to investigate the role of brain tumours causing deafness in children and adults and the development of therapies using in vitro models. These tumours and a variety of other ...

Study provides documentation that tumor 'stem-like cells' exist in benign tumors

LOS ANGELES (July 22, 2009) Cancer stem-like cells have been implicated in the genesis of a variety of malignant cancers. Research scientists at Cedars-Sinai Medical Center's Maxine Dunitz Neurosurgical Institute have isolated stem-like cells in benign (pituitary) tumors and used these "mother" c...

More>>

Tumor in Medical Technology

Proteolix Presents Phase 1b/2 Clinical Data for Carfilzomib in Advanced Solid Tumor Patients at the 2009 ASCO Annual Meeting

Promising Anti-cancer Activity Observed in Relapsed Patients ORLANDO, Fla., and SOUTH SAN FRANCISCO, Calif. , May 30 /PRNewswire/ -- Proteolix, Inc. today reported on clinical advances for its carfilzomib solid tumor program in an oral presentation at the 2009 Annual Meeting of the American S...

Semafore's SF1126, a Vascular Targeted Pan-PI3K/mTOR Inhibitor, Is Well Tolerated and Demonstrates Activity in Phase I Solid Tumor Patients

Clinical Data Presented at the 2009 ASCO Meeting INDIANAPOLIS, May 30 /PRNewswire/ -- Semafore Pharmaceuticals, Inc., a privately held cancer drug discovery and development company, today presented data from a Phase I clinical trial of its vascular targeted pan-PI3K/mTORC1/2 inhibitor, SF1126...

Video: Data on More Than 15 Novartis Oncology Compounds at ASCO Highlight Progress Toward Targeted Therapies for Diverse Tumor Types

- Oral presentation on Sandostatin(R) LAR Depot Phase III data shows significant antitumor benefit in patients with advanced neuroendocrine tumors of the midgut - Early data show that at eight weeks of treatment, Afinitor(R) stabilized or reduced tumor size in 61% of patients with advanced...

Poniard Pharmaceuticals to Present New Data from Phase 2 Clinical Trials of Picoplatin in Multiple Tumor Types at the 45th Annual Meeting of the American Society of Clinical Oncology

- Progression-Free Survival Data to be Presented for Phase 2 Colorectal and Prostate Trials - - Company to Hold Investor Event on Sunday, May 31 with Oncology Experts - SOUTH SAN FRANCISCO, Calif., May 4 /PRNewswire-FirstCall/ -- Poniard Pharmaceuticals, Inc. (Nasdaq: PARD ) today ann...

Genes Identified That Enhance Tumor Cell Sensitivity to CTI's Cancer Drug Brostallicin

Identifies potential clinical trial strategies for personalized approach to cancer treatment SEATTLE, April 21 /PRNewswire-FirstCall/ -- Systems Medicine, LLC (SM), a wholly-owned subsidiary of Cell Therapeutics, Inc. (CTI) (Nasdaq and MTA: CTIC), presented data from a preclinical study, whic...

New Imaging Analysis Predicts Brain Tumor Survival

U-M researchers develop 'parametric response map' to analyze changes in a tumor's blood flow, volume ANN ARBOR, Mich., April 20 /PRNewswire-USNewswire/ -- As early as one week after beginning treatment for brain tumors, a new imaging analysis method was able to predict which patients would li...

More>>

Tumor in Medical Products

Gastrointestinal Stromal Tumor Mutation

Description: ARUP Laboratories is a national reference laboratory and a worldwide leader in innovative laboratory research and development. ARUP offers an extensive test menu of highly complex and unique medical tests in clinical and anatomic pathology. Owned by the University of Utah, ARUP Laboratories' client...
Company:ARUP Laboratories

Cytology, Bladder Tumor Associated Antigen

Description: ARUP Laboratories is a national reference laboratory and a worldwide leader in innovative laboratory research and development. ARUP offers an extensive test menu of highly complex and unique medical tests in clinical and anatomic pathology. Owned by the University of Utah, ARUP Laboratories' client...
Company:ARUP Laboratories

Bladder Tumor Associated Antigen (BTA statTest)

Description: ARUP Laboratories is a national reference laboratory and a worldwide leader in innovative laboratory research and development. ARUP offers an extensive test menu of highly complex and unique medical tests in clinical and anatomic pathology. Owned by the University of Utah, ARUP Laboratories' client...
Company:ARUP Laboratories

Lyphochek Tumor Marker Control

Description: Lyphochek Tumor Marker Control is a comprehensive, bilevel product designed to assess the performance of various cancer antigen tests, including esoteric tumor markers....
Company:Bio-Rad Laboratories

Chromosome Analysis, Solid Tumor

Description: ARUP Laboratories is a national reference laboratory and a worldwide leader in innovative laboratory research and development. ARUP offers an extensive test menu of highly complex and unique medical tests in clinical and anatomic pathology. Owned by the University of Utah, ARUP Laboratories' client...
Company:ARUP Laboratories

Free Activin AB ELISA Test

Description:...perfamily. The TGF- superfamily is a large group of extra-cellular growth factors which control many aspects of development, reproductive function and tumor formation (1). Other members incude TGF-s, bone morphogenetic proteins, growth differentiation factors, AMH/MIS (Anti-Mullerian Hormone/Mullerian Inhi...
Company:Diagnostic Systems Laboratories, Inc.

More>>

Tumor in Medical Definition

Anterior mediastinal mass

...ds . You can discuss the issue on the talk page . Thymoma Main article: thymoma Most common primary anterior mediastinal tumor (20%) in adults but rarely seen in children. It can be classified as lymphocytic, epithelial, or spindle cell histologies, but this is not very signif...

Cachexia

...stood, but there is probably a role for inflammatory cytokines such as tumor necrosis factor alpha (TNF-α) -which is also nicknamed cachexin for this...on-, Interferon gamma (IFNɣ), and Interleukin 6 (IL-6), as well as the tumor secreted proteolysis inducing factor (PIF). Related malnutrition syndr...

Clean margin

... A clean margin is a medical term referring to the attempt in surgical oncology to resect a tumor with no portion of the malignant growth on microscopic examination by a pathologist extending past a set delineation known as the 'tumor margin'. [...

Fat transfer

...the bone . [1] In 1895, another German doctor, Dr. Karl Czerny did the very first documented breast augmentation when he transplanted a fatty tumor from the patient’s lumbar region , or lower back, to a breast defect. [2] Overview of Current Fat Transfer Techniques In the 1980s,...

Pathology

... ( C00-D48 ) Benign tumors Hyperplastic tumor - Cyst - Pseudocyst - Hamartoma - Benign n...carcinoma - Choriocarcinoma - Endodermal sinus tumor - Teratoma - Adenoma / adenocarcinoma - Soft... - Experimental cancer treatment Misc. tumor suppressor genes / oncogenes - Staging / grading...

Ocular oncology

...ma and retinoblastoma . The most common eyelid tumor is called basal cell carcinoma . This tumor can grow around the eye but rarely spreads to othe... The most common malignant primary intraocular tumor in adults is melanoma . Though most attention i...
Tumor in Medical Dictionary

Tumor

Tumor information including symptoms, diagnosis, misdiagnosis, treatment, causes, patient stories, videos, forums, prevention, and prognosis. Symptoms of Tumor including 3 medical symptoms and signs of Tumor , alternative diagnoses, misdiagnosis, and correct diagnosis for Tumor signs o...

Spinal tumor

Spinal tumor — Comprehensive overview covers symptoms, treatment of growth in or near spinal cord. ... A spinal tumor , whether cancerous or not, can threaten ... Spinal tumor — Comprehensive overview covers symptoms, treatment of growth in or near spinal cord. ... Spinal ...

Primary brain tumor

... intracranial tumor created by abnormal cell division in the brain . Includes description, types of tumors , symptoms, ... Primary (true) brain tumors are ... There are many types and subtypes of primary brain tumors . ... Although primary brain tumors often s...

Pituitary tumor

Pituitary adenomas are tumors that occur in the pituitary gland, and account for about 10% of intracranial neoplasms. They often remain undiagnosed, and small pituitary tumors have an estimated prevalence of 16.7% . Non-profit organization for patients with pituitary tumors and diso...

Metastatic brain tumor

Educational and hospital on Gamma Knife and Linac stereotactic radiosurgery for brain tumors and disorders. ... Metastatic brain tumors present with the usual ... Metastatic brain tumors occur in about one-fourth of all cancers that ... Surgery may be used for metastatic br...

Lung tumor

Lung cancer is a disease of uncontrolled cell growth in tissues of the lung . This growth may lead to metastasis, which is the invasion of adjacent tissue and infiltration beyond the lungs. The vast majority of primary lung ... Lung tumors . Last revised 5 May 2009. Last major ...

More>>

Tumor in Biological News

La Jolla Institute discovers novel tumor suppressor

SAN DIEGO (August 3, 2009) La Jolla Institute for Allergy & Immunology researchers studying an enzyme believed to play a role in allergy onset, instead have discovered its previously unknown role as a tumor suppressor that may be important in myeloproliferative diseases and some types of lymphoma...

Nanoparticle-delivered 'suicide' genes slowed ovarian tumor growth

PHILADELPHIA Nanoparticle delivery of diphtheria toxin-encoding DNA selectively expressed in ovarian cancer cells reduced the burden of ovarian tumors in mice, and researchers expect this therapy could be tested in humans within 18 to 24 months, according to a report in Cancer Research , a journ...

Potential for non-invasive brain tumor treatment

DURHAM, N.C. -- Duke University engineers have taken a first step toward a minimally invasive treatment of brain tumors by combining chemotherapy with heat administered from the end of a catheter. The proof-of-concept study demonstrated that it should be technically possible to treat brain tum...

Computer model predicts brain tumor growth and evolution

PROVIDENCE, R.I. [Brown University] Researchers from Brown University and other institutions have developed a computational computer model of how brain tumors grow and evolve. The model is the product mathematical formulas based on the first principals of physics, such as conservation of mass,...

From cars to cancer: UH professor employs auto industry tools for tumor therapy

An effort is under way at the University of Houston to use technologies with origins in the automobile industry to develop new tools that will help doctors and technicians better plan radiation therapy for patients with head and neck cancer. Dr. Ali Kamrani, founding director of the Design and ...

Hebrew University researchers neutralize tumor growth in embryonic stem cell therapy

Jerusalem, May 5, 2009 Researchers at the Hebrew University of Jerusalem have discovered a method to potentially eliminate the tumor-risk factor in utilizing human embryonic stem cells. Their work paves the way for further progress in the promising field of stem cell therapy. Human embryonic ...

More>>

Tumor in Biological Technology

Monitoring Circulating Tumor Cells With the CellSearch(R) System Can Predict Prognosis in Metastatic Breast Cancer

RARITAN, N.J., July 13 /PRNewswire/ -- Measuring the change in circulating tumor cell (CTC) count can accurately predict the prognosis and survival in patients with metastatic breast cancer (MBC), according to a newly published report in the July 10 issue of the Journal of Clinical Oncol...

OncoGenex Pharmaceuticals Announces OGX-427 Treatment Demonstrates Safety, Evidence of Declines in Circulating Tumor Cells and Reductions in Tumor Markers in a Phase 1 Cancer Trial

BOTHELL, WA, and VANCOUVER, May 30 /PRNewswire-FirstCall/ - OncoGenex Pharmaceuticals, Inc. (NASDAQ: OGXI ) today announced preliminary results of a Phase 1 trial presented during an oral presentation at the American Society of Clinical Oncology (ASCO) Annual Meeting. Preliminary results as of A...

Fat droplet nanoparticle delivers tumor suppressor gene to tumor and metastatic cells

Dr. Esther Chang describes the most recent developments in human trials of the first systemic, non-viral, tumor-targeted, nanoparticle method designed to restore normal gene function to tumor cells while completely bypassing normal tissue April 21 at an American Association of Anatomists (AAA) sci...

Pre-Clinical Data on CEA-specific BiTE Antibody Published in Journal of Immunotherapy Demonstrate Potent Control of Tumor Growth

BETHESDA, Md., April 8 /PRNewswire-FirstCall/ -- Micromet, Inc. (Nasdaq: MITI ), a biopharmaceutical company developing novel, proprietary antibodies for the treatment of cancer, inflammation and autoimmune diseases, today announced the publication of data in the peer-reviewed Journal of Immunot...

Sigma-Aldrich Introduces MISSION(R) LentiPlex(TM) Pooled shRNA Libraries to Enable Rapid Whole Genome Screening in Primary Cells, Stem Cells or Tumor Cells

ST. LOUIS, March 3 /PRNewswire-FirstCall/ -- Sigma-Aldrich (Nasdaq: SIAL ) today announced the global release of the MISSION(R) LentiPlex(TM) Pooled Human and Murine shRNA Libraries ( http://www.sigma-aldrich.com/lentiplex ). Using the shRNA collections of The RNAi Consortium (TRC), the ...

Poniard Pharmaceuticals Announces Positive Tumor Response and Neuropathy Data from Phase 2 Clinical Trial of Picoplatin in Metastatic Colorectal Cancer

- Incremental Data to be Presented at ASCO GI Symposia Continue to Support Picoplatin as Neuropathy-Sparing Alternative to Oxaliplatin in First-Line Colorectal Cancer Treatment - SOUTH SAN FRANCISCO, Calif., Jan. 14 /PRNewswire-FirstCall/ -- Poniard Pharmaceuticals, Inc. (Nasdaq: PARD ), a ...
Tumor in Biological Products

Rabbit Anti-Wilm's tumor Polyclonal Antibody, Unconjugated from Abcam

Description: Rabbit polyclonal to Wilms Tumor Protein ( Abpromise for all tested applications). entrezGeneID: 7490 SwissProtID: P19544...
Company:Abcam

Mouse Anti-LATS, large tumor suppressor, homolog 2 (Drosophila) Monoclonal Antibody, Unconjugated, Clone 3D10 from Novus Biologicals

Description: Mouse monoclonal antibody to Lats2....
Company:Novus Biologicals

RAW 264.7 cell line slides ( mouse: Abelson murine leukemia virus - induced tumor ) from GeneTex

Description: Mouse RAW 264. 7 cells were cultured in DMEM with 4 mM L-glutamine medium and harvested at the log phase of growth. In order to keep the antigens in their native forms, cells were fixed in acetone-methanol. The cells are arrayed on a 12-well (5 mm) adhesive coated slide, with each wells surface s...
Company:GeneTex

Rabbit Anti-Wilm's Tumor Protein Polyclonal Antibody, Unconjugated from Calbiochem

Description: Anti-WT-1 Liquid. In 10 μM PBS, 0.2 % BSA, pH 7.6. Recognizes the ~47-55 kDa Wilm's tumor protein in Wilm's tumor tissue. ...
Company:Calbiochem

Rabbit Anti-Wilm's tumor Polyclonal Antibody, Unconjugated from Novus Biologicals

Description: Rabbit anti-Wilm's tumor, Polyclonal Antibody, Unconjugated Applications: IHC-P: Use at a dilution of 1/100. IP: Use at an assay dependent dilution. WB: Use at an assay dependent dilution. Predicted molecular weight: 51 kDa. Not tested in other applications. Optimal dilutions/concentratio...
Company:Novus Biologicals

Anti-Human Monoclonal Antibody, Unconjugated, Clone 115D8 from Cell Sciences

Description:... Anti-human Carcinoma Associated Antigen, Clone 115D8, Monoclonal Antibody Innate Immunity - tumor Markers...
Company:Cell Sciences

More>>

Tumor in Biological Definition

Tumor

See the article about cancer for the main article about malignant tumors. Tumor ( American English ) or tumour ( British English ) originally means "swelling", and is sometimes still used with that meaning. Tumor meaning swelling is one of the five classical characteristics of inflammat...

Apoptosis

... 3.1 Apoptosis and the role of interferon in tumor suppression 3.2 Cancer and defective apoptotic pathways 3.3 Role of apoptotic products in tumor immunity 4 History and highlights in apopt...ng faster than they die, effectively developing a tumor . The cells are dividing slower than they die, ...

Blood

...nal elements to tissues and to remove waste products (such as carbon dioxide and lactic acid ). Blood also enables cells ( leukocytes , abnormal tumor cells) and different substances ( amino acids , lipids , hormones ) to be transported between tissues and organs. Problems with blood composition o...

Cancer

...liferation of cells can lead to either a benign tumor or a malignant tumor (cancer). Benign tumors do not spread to other par...groups: Local symptoms : unusual swelling ( tumor in Latin means swelling), hemorrhage (bleedi...

Cytotoxic T cell

... its surface antigen receptors that can bind to fragments of antigens displayed by the Class I MHC molecules of virus infected somatic cells and tumor cells. Once activated by a MHC-antigen complex, T C cells release the protein perforin , which forms pores in the target cell's plasma membran...

Morphogenesis

... entire organisms and the positions of the various specialized cell types. Cell growth and differentiation can take place in cell culture or inside of tumor cell masses without the normal morphogenesis that is seen in an intact organism. The study of morphogenesis involves an attempt to understand the proc...
Tumor in Biological Dictionary

Tumor

A tumor or tumour is the name for a swelling or lesion formed by an abnormal growth of cells . Tumor is not synonymous with cancer. A tumor can be benign, pre-malignant or malignant, whereas cancer is by definition malignant. tumor n. An abnormal growth of tissue resulting from unc...

Viral oncogene

...resented by 916 ESTs from 176 cDNA libraries. ... Homo sapiens FBJ murine osteosarcoma viral oncogene -like B variant 8 (FOSB) mRNA, ... ... by tumor viruses that do not themselves carry a viral oncogene . ... IT MAY BE TRANSMITTED BY A VIRUS IN WHICH CASE WE REFER TO IT AS A VIRAL ONCOGENE ....

Vascular system

...; Development of the Vascular System . TABLE OF CONTENTS. I. Embryology ... The formation new blood vessels, or angiogenesis, an Achilles' heel tumor growth, ... Complex Changes in the Brain's Vascular System Occur after Menopause ... ...

Untranslated RNA

...3'UTR RNA from Alpha-Tropomyosin Gene Suppresses tumor Activity. ... Expression of prohibitin 3' untrans... :: physiology; Research Support, Non-U.S. ... tumor Suppression by the Prohibitin Gene 3' Untranslated...- or 3′- untranslated regions (UTRs) of mRNA. ... tumor suppression by RNA from the 3′ untranslated ...

Untranslated region

... region (3' UTR) is a particular ... article "Three prime untranslated region ". Read more ... 3'UTR RNA from Alpha-Tropomyosin Gene Suppresses tumor Activity. ... Tropomyosin-2 cDNA lacking the 3' untranslated region riboregulator induces ... Untranslated , region ,biological ,biology dicti...

Tumor suppressor

... A tumor suppressor gene, or antioncogene, is a gene t...ges. will be reviewed below, a large number of tumor suppressor genes ... Thus far, about 30 tumor suppressor ... a unique subset of the ...
Other TagsHandleHandleMultivitamins
(Date:11/24/2009)..., NEWYORK,Nov.24/PRNewswire-USNewswire/--Ther...oblems.Itisharmreduction,offeringpragmaticandreali...roblemshavefailed.Spearheadingthismovementisagroup...rationSupport.HAMSisafree-of-charge,lay-ledsupport..., TheNationalInstituteonAlcoholAbuseandAlcoholism...
(Date:11/24/2009)..., NEWYORK,Nov.24/PRNewswire/--TheGuardianLife...tmutuallifeinsurersandaleadingproviderofemployeebe...thatthecompanywillcontinuetofollowitscurrentinsura...eguidelinesareconsistentwiththeAmericanCancerSocie...sformammographyscreenings. ,, Recently,TheU.S.P...
(Date:11/24/2009)..., ChangesMustBeMadetoUSPSTFRepresentationand...ewswire-USNewswire/-- SeveralsectionsofSenatehealt...hatinsuranceentitiessuchasprivateinsurers,Medicare...vingaspecificgradefromtheU.S.PreventativeServicesT...icesforwomen40-49,wouldonlyrequirecoverageofbienni...
(Date:11/24/2009)... BEER-SHEVA, ISRAEL November 24, 2009 Researchers...ing a new device that detects cancerous skin tumor...naked eye. , During initial testing, the OSPI in...vealed new textures of lesions that have never bee... were diagnosed with various skin lesions and were...
(Date:11/24/2009)... INDIANAPOLIS Involving family members of pediatr...s benefits both the family and the medical team, a...icine study. , Riley Hospital for Children, whe...mall number of hospitals nationwide routinely offe...y patients the opportunity to join their child,s m...
Breaking Medicine News(10 mins):Health News:Harm Reduction for Alcohol: An Idea Whose Time Has Arrived 2Health News:USPSTF Mammography Recommendations Should Be Specifically Excluded From Health Care Reform Legislation 2Health News:USPSTF Mammography Recommendations Should Be Specifically Excluded From Health Care Reform Legislation 3Health News:New device enables early detection of cancerous skin tumors -- Ben Gurion U. 2Health News:Involving family in medical rounds benefits both family and medical team 2Health News:Involving family in medical rounds benefits both family and medical team 3Health News:Involving family in medical rounds benefits both family and medical team 4
(Date:11/24/2009)... protein that may help gut bacteria bind to the ga... probiotic producers to identify strains that are ...tics need to interact with cells lining the gut to...urfaces in the gut they are more likely to stick a...r Nathalie Juge from the Institute of Food Researc...
(Date:11/24/2009)...mber 24, 2009) -- The Wildlife Conservation Societ...e last remaining population of Siberian tigers has...ide of poaching and habitat loss. , ...ials of what needs to be done to protect remaining... The report was released by the Siberian Ti...
(Date:11/24/2009)... Spanish . , The presence of increased body ...ubstances in the blood, hinders the loss and maint...ect of the University of Navarra conducted by Estb... Pharmacy. , The project, entitled "A nutrigenet...ol of body weight and inflammation," examines how ...
Breaking Biology News(10 mins):A sticky solution for identifying effective probiotics 2Report shows dramatic decline in Siberian tigers 2It can be predicted the reaction obese patients will have to a diet 2Shrinking Bylot Island glaciers tell story of climate change 9745 1Shrinking Bylot Island glaciers tell story of climate change 9745 2Shrinking Bylot Island glaciers tell story of climate change 9745 3Shrinking Bylot Island glaciers tell story of climate change 9745 4Kaiser Workers Statewide Campaign Starts Tuesday 55751 1Kaiser Workers Statewide Campaign Starts Tuesday 55751 2This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 1This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 2This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 3This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 4
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria