Navigation Links


ppp at Biology News

ppp at Biology Products

G(5)ppp(5)G from Ambion

Description:...
Company:

m7G(5)ppp(5)G (Cap Analog) from Ambion

Description:m7G(5')ppp(5')G (Cap Analog) is used for the synthesis of 5' capped RNA molecules in in vitro transcription reactions. Substitution of cap analog for a large portion of the GTP in an in vitro transcription reaction results in the incorporation of the cap structure into a large fraction of the transcripts. Capped mRNAs are generally translated more efficiently in reticulocyte lysate and wheat germ...
Company:Ambion

m7G(5)ppp(5)G (Cap Analog) from Ambion

Description:m7G(5')ppp(5')G (Cap Analog) is used for the synthesis of 5' capped RNA molecules in in vitro transcription reactions. Substitution of cap analog for a large portion of the GTP in an in vitro transcription reaction results in the incorporation of the cap structure into a large fraction of the transcripts. Capped mRNAs are generally translated more efficiently in reticulocyte lysate and wheat germ...
Company:Ambion

Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant PPP4C. GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*...
Company:Abnova Corporation

Mouse Anti-Human PPP2R2C Monoclonal Antibody, Unconjugated, Clone 6D1 from Novus Biologicals

Description:Mouse monoclonal antibody to PPP2R2C - protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform...
Company:Novus Biologicals

More>>

ppp at Biology Technology

Mx4000 Multiplex Quantitative PCR System*,PPP

Stratagene has improved upon currently available QPCR machines with the Mx4000 multiplex quantitative PCR system. This new system offers better performance and functionality at a more economical price. Real-time quantitative PCR (QPCR) allows researchers to quickly and easilyquantify nuclei...
ppp at Medicine News
ppp at Medicine Products

Appasamy Phaco Choppper

Description:1.5 mm inner cutting edge....
Company:Appasamy Associates
ppp at Medicine Technology
Other TagsDiarrhoeaSpiceInteractionsInteractionsSolving
(Date:8/21/2008)... New names and fresh websit... UME/GME administration software , ... one45 Software, a leading provider of healthcare ... of Cytiva Software Inc. (CRX:TSX.V), announced to...hcare education administration products., , ,Compl...
(Date:8/20/2008)... NEWTON, Mass., Aug. 20 /PRNewswire/ -- Questex M...o-business media company and owner of,American Spa... and the,International Beauty Shows, the Internati...) and the SPATEC appointment events today announce...stry portals SpaTrade (, http://www.SpaTrade.com ...
(Date:8/20/2008)... Survey Report Is Available at http://ww...Newswire/ -- A new survey released today,documents...re leveraging,health information technology (HIT) ...The survey results highlight the need for many HIT...dization and,interoperability to optimize clinical...
(Date:8/20/2008)...use postponed reproductive onset in teen, adult fe...EDNESDAY, Aug. 20 (HealthDay News) -- Alcoholism i...ccording to a study that compared women,s and men,... age when they had their first child. , The re...ian twins born between 1893-1964 (3,634 female and...
Breaking Medicine News(10 mins):Health News:Cytiva's one45 Software Rebrands Healthcare Education Administration Products 2Health News:Cytiva's one45 Software Rebrands Healthcare Education Administration Products 3Health News:Cytiva's one45 Software Rebrands Healthcare Education Administration Products 4Health News:Questex Acquires Leading Spa Industry Portal and Spa Executive Business Networking Site and Events 2Health News:Questex Acquires Leading Spa Industry Portal and Spa Executive Business Networking Site and Events 3Health News:New Health IT Survey for Care Management Services Shows Opportunities for Integration, Standardization and Innovation 2Health News:New Health IT Survey for Care Management Services Shows Opportunities for Integration, Standardization and Innovation 3Health News:Women's Alcohol Use Tied to Delayed Childbearing 2
(Date:8/20/2008)...g (MRI) isn,t just for capturing detailed images o...ents and technology developed by Carnegie Mellon U...o visualize with "exquisite" specificity cell po...ity to non-invasively locate and track cells, such...reatment of cancer, inflammation, and autoimmune d...
(Date:8/20/2008)...d with Additional Funding by Syncom Venture Partn...uding Lockheed Martin, GE Security, Baker Capit...swire/ -- Clear(R), the fast pass for airport,secu.... Led by new investor,Spark Capital, this round al...ers, and existing investors Lockheed Martin, GE Se...
(Date:8/20/2008)...odeine may be risky for some,breastfeeding mother...estern Ontario, and the Hospital for Sick Children...ren published research in the journal, Clinical P...e codeine used in some pain relief drugs can actua...s when ingested by some breastfeeding mothers. , ...
(Date:8/20/2008)...t an interdisciplinary and coordinated research ag...ce and influencing policy, a group of experts has ...g of how mercury moves through the marine ecosyste...th,s Toxic Metals Research Program convened the gr...tors, and public health experts in November 2006 t...
Breaking Biology News(10 mins):Carnegie Mellon MRI technology that non-invasively locates, quantifies specific cells in the body 2Carnegie Mellon MRI technology that non-invasively locates, quantifies specific cells in the body 3Clear(R) Secures $44.4 Million in Venture Funding 2Clear(R) Secures $44.4 Million in Venture Funding 3Codeine not safe for all breastfeeding moms and their babies 2Dartmouth workshop sets research agenda for environmental mercury 2Perot Systems and ChinaSoft to Pursue Chinese Healthcare Opportunities 14594 1Perot Systems and ChinaSoft to Pursue Chinese Healthcare Opportunities 14594 2Springer to publish new journal focusing on ethical issues in neuroscience 14592 1Springer to publish new journal focusing on ethical issues in neuroscience 14592 2Uric acid may provide early clues to diabetic kidney disease 14589 1Uric acid may provide early clues to diabetic kidney disease 14589 2Cystic Fibrosis Foundation announces 245 million initiative to enhance care for adults with CF 14586 1Cystic Fibrosis Foundation announces 245 million initiative to enhance care for adults with CF 14586 2
Other Contentsanterioranterioranterioranterioranterioranteriorstiffnessstiffnessstiffnessstiffnessstiffnessinductioninductioninductioninductioninductioninductioninductioninductioninductioninductionbirthbirthbirthbirthbirthbirthbirthbirthswitchedswitchedswitchedswitchedswitchedswitchedbabiesbabiesbabiesbabiesbabiesbabiesregulatorregulatorregulatorregulatorregulatorregulatorregulatorregulator