Navigation Links


PLUG in Medical News

QLT announces interim data from a Phase II clinical trial and a device study for the Punctal Plug Drug Delivery System

VANCOUVER, July 28 /PRNewswire-FirstCall/ - QLT Inc. (NASDAQ: QLTI ; TSX: QLT) ("QLT" or the "Company") today announced encouraging interim data from an ongoing Phase II clinical trial and a device study for the punctal plug delivery system. These studies are part of a development program that i...

Anti-Smoking Web Site Helps Parents Plug Into Prevention

High-tech resource keeps prevention conversation accessible to parents GREENSBORO, N.C., Oct. 29 /PRNewswire/ -- Is there a doctor in the house? Yes, there is, thanks to the sponsorship of Lorillard Tobacco Company. Families throughout the country who'd love to have the help and advice of a...

QLT announces encouraging Phase II data from core study of Punctal Plug Drug Delivery System

Sustained release treatment leads to reduction in IOP of 20% from baseline at 12 weeks VANCOUVER, Oct. 28 /PRNewswire-FirstCall/ - QLT Inc. (NASDAQ: QLTI; TSX: QLT) ("QLT" or the "Company") today announced data from its CORE study, a Phase II trial being conducted by QLT's wholly-owned subsid...

AGA Medical Corporation Receives CE Mark Approval for the AMPLATZER(R) Vascular Plug III

MINNEAPOLIS, May 15 /PRNewswire/ -- AGA Medical Corporation ("AGA") announced today it received CE mark approval to market the AMPLATZER(R) Vascular Plug III ("AVP III"). AGA also announced the immediate availability and launch of the device in the European Union. The AVP III further expands t...

ExoSeal vascular plug gets good reviews in ECLIPSE study

CHICAGO, Ill. (April 1, 2008) A new bioabsorbable plug that seals the arterial puncture site used for threading catheters into the body during diagnostic angiography and interventional procedures significantly shortens bleeding time and enables patients to get up and walk around far sooner than w...

QLT initiates phase II study of punctal plug drug delivery system for glaucoma & ocular hypertension

VANCOUVER, March 31 /PRNewswire-FirstCall/ - QLT Inc. (NASDAQ: QLTI; TSX: QLT) announced today the initiation of patient recruitment into its "CORE" study, a phase II trial being conducted by QLT's wholly-owned subsidiary, QLT Plug Delivery, Inc. ("QPD"), to evaluate the preliminary efficacy a...

More>>

PLUG in Medical Products

SOFT PLUG Silicone Punctum Plugs

Description: The distinctive low profile dome head combined with a softer more flexible silicone maximizes patient comfort. The pointed nose design simplifies insertion and the large anchor with wide shelf firmly secures plug making dislocation less likely. The inserter provides greater control and eliminates ...
Company:Oasis Medical

SOFT PLUG Extended Duration Plugs

Description: Extended Duration absorbable plugs are designed to provide patient comfort for up to 3 months. This long lasting plug is effective and economical for transient dry eye symptoms following surgery. Extended Duration plugs are 2mm in length....
Company:Oasis Medical

Disposable Punctum Dilator and Plug Inserter

Description: Recommended to insert plug portion of all monocanalicular intubation systems into punctum....
Company:FCI Ophthalmics Inc.

Scleral Plug Forceps

Description: Designed to securely hold scleral plugs during insertion and removal. The cross action handle is designed to reduce hand fatigue while grasping plug....
Company:Bausch & Lomb Storz

ProLong Absorbable Long Term Plug

Description: Lasts up to 3 months Absorbable copolymer of glycolic acid and trimethylene carbonate Designed to provide relief from short term dry eye conditions. Appropriate for surgery-related dry eye symptoms ...
Company:FCI Ophthalmics Inc.

Premilene Mesh LP Self-Forming Plug

Description: Premilene Mesh LP Self-Forming Plug is combining a lightweight mesh material with the Self-Forming philosophy. This results in a very soft hernia plug which stands for a high patient comfort. Compared to standard Plugs less foreign body material is included in Premilene Mesh LP Self-Forming Plug. W...
Company:AESCULAP

More>>

PLUG in Medical Dictionary

Tracheostomy

... the tracheostomy may still be needed for. some time to help the patient breathe ... tracheostomy tube, the doctor may. cover the opening with a plug to test the ... Tracheostomy ... A tracheostomy is a surgical procedure to create an opening through the neck ... If the tracheostomy tube i...

Suppository

...solves. suppository n. , pl. -ries . A small plug of medication designed to melt at body temperatur...an the mouth, especially suppository a small plug of medication designed for insertion into the rec...ions - (noun) 1. anal suppository : small tapered plug of ... suppository rectum laxative ass taint ...

Remedy

...cial online destination for Band, latest news, release information, videos, tour dates and downloads ... Welcome to Band! You will require the Flash 7 plug ... Ortho Remedy Inc. NY NJ. Prosthetic Center of Excellence. Proudly Serving NJ, NY Since 1976. Remedy is a 5 piece cover band in Norther...

Platelet

... Increased platelet CD62p expression and increased PMPs were most pronounced in ... Platelet – leucocyte and endothelial cell conjugation may plug coronary ... Platelet - Definition of Platelet at Dictionary.com a free online dictionary ... Low Platelet Disease. Get Information about Lo...

Nebulizer

... Nebulizer Guidelines. Using a nebulizer is different from using a ... Before using your nebulizer , put it on a firm surface such as a table and plug ... A pediatric nebulizer , also called a breathing machine, is used to give asthma ... A nebulizer is a small, handheld compressed air mac...

Infarct

... greater ... Online Medical Dictionary and glossary with medical definitions ... The word " infarct " comes from the Latin "infarcire" meaning "to plug up or cram. ... Infarct - Definition of Infarct at Dictionary.com a free online dictionary with ... Link To infarct . Kernan Hospital. Stroke...
PLUG in Biological News

Scientists work to plug microorganisms into the energy grid

The answer to the looming fuel crisis in the 21st century may be found by thinking small, microscopic in fact. Microscopic organisms from bacteria and cyanobacteria, to fungi and microalgae, are biological factories that are proving to be efficient sources of inexpensive, environmentally friendly...

New theory on why male, female lemurs same size

...their mates. They do this by depositing a solid plug inside the female's reproductive tract just as they finish mating. The plug is deposited as a liquid protein but quickly harde...males for only one day out of the entire year, the plug serves the purpose of preventing other males from ...

Energy-saving method checks refrigerant level in air conditioners

...d with the new refrigerant-charge system could activate a warning light on a car's dashboard. Technicians servicing home air conditioners might simply plug a personal digital assistant into the unit to read the refrigerant-charge information, Braun said. Researchers began developing the technique four ...

RNA research strategy for Europe takes shape

...xt ten years. Three earlier workshops had examined various aspects of RNA research to identify where gaps in our knowledge lie and what is required to plug these gaps and fulfil the promise that RNA holds. Forward Looks are a key part of ESF's work, examining important areas of science and technology in c...

CSHL researchers identify gene that helps plant cells keep communication channels open

...alled callose. Although callose is a normal structural component of cell walls in plants, excess callose accumulates and forms obstructive clumps that plug the plasmodesmata and impede the flow of traffic through the channels. Restricting flow can be beneficial in some instances, such as when damaged ...

While focusing on heart disease, researchers discover new tactic against fatal muscular dystrophy

...cle fibers. Andrew Marks, M.D., the study's leader, hypothesized that a new class of experimental drugs developed at CUMC which he had designed to plug the leak in the heart could also work for Duchenne. The drugs, when given to mice with Duchenne, dramatically improved muscle strength and reduced...
PLUG in Biological Technology

Pharma and Biotech Companies Plug into Singapore's Integrated Research Network

ATLANTA, May 19 /PRNewswire-Asia/ -- Leading pharmaceutical and biotech companies are drawing on Singapore's integrated network of public-sector and academic institutes to enhance their R&D productivity, leverage academic insights and diversify risks. Located at the heart of Asia with a po...

QLT reports initial proof of concept data for punctal plug delivery technology

Small study supports the potential for QLT's drug elution technology to reduce and sustain intraocular pressure VANCOUVER, May 12 /PRNewswire-FirstCall/ - QLT Inc. (NASDAQ: QLTI; TSX: QLT) announced today results from a proof of concept trial conducted by QLT's wholly-owned subs...

AGA Medical Corporation Receives FDA and CE Mark Approvals for the AMPLATZER Vascular Plug II

MINNEAPOLIS, Aug. 24 /PRNewswire/ -- AGA Medical Corporation ("AGA") announced today that it has received U.S. Food and Drug Administration (FDA) and European CE Mark approvals for the AMPLATZER Vascular Plug II ("vascular plug II"). The AMPLATZER Vascular Plug II expands the AGA family of oc...

Cellular Dynamics International In-Licenses Key Patent Portfolio for Using Stem Cell-Derived Cells in Drug Testing

...rug testing. Financial terms of the license were not disclosed. "CDI is building an industrial pipeline and automated process enabling us to plug in different cell types and generate large quantities of purified cells," said Chris Kendrick-Parker , chief commercial officer of CDI. "That is th...

Angiotech announces positive results from Bio-Seal(TM) clinical study

...udy results for its Bio-Seal(TM) Lung Biopsy Tract plug System at the Society of Interventional Radiologis...s the safety and efficacy of an expanding hydrogel plug in reducing pneumothorax rates associated with CT-... and distributor of the Bio-Seal Lung Biopsy Tract plug System, which has already received CE Mark approva...

Edmond Scientific Company 'Spotlight on the Executive':

...meworks. Throughout the course of his career, Mr. Mallia has been involved in many interoperability projects, including the design and construction of plug compatible data communication devices, satellite and wireless digital data broadcast systems, enterprise integration and electronic health information...
PLUG in Biological Products

Corning Culture Flask, 25 cm2, Tc-Treated, Canted Neck, Plug Seal, Sterile from Sigma-Aldrich

Description: This CLS number is a new product number, created to easily match Cornings product number. If showing no availability yet, please order under the old Sigma-Aldrich number (C7046) or contact customer service for assistance. Mfr Desig: Corning No.430168...
Company:Sigma-Aldrich

Corning Culture Flask, 75 cm2, Tc-Treated, Angled Neck, Plug Seal, Sterile from Sigma-Aldrich

Description: This CLS number is a new product number, created to easily match Cornings product number. If showing no availability yet, please order under the old Sigma-Aldrich number (C7296) or contact customer service for assistance. Mfr Desig: Corning No.430720...
Company:Sigma-Aldrich

Corning Erlenmeyer Flask, Pc, 250 ml, Plug Seal Cap, Sterile from Sigma-Aldrich

Description: This CLS number is a new product number, created to easily match Cornings product number. If showing no availability yet, please order under the old Sigma-Aldrich number (Z35,347-7) or contact customer service for assistance. Mfr Desig: Corning 430183...
Company:Sigma-Aldrich

CORNING ROLLER BOTTLES, 490 CM2, PS CAP, PLUG SEAL, STERILE from Sigma-Aldrich

Description: This CLS number is a new product number, created to easily match Cornings product number. If showing no availability yet, please order under the old Sigma-Aldrich number (R3776) or contact customer service for assistance. Material: cap polystyrene (plug seal) Mfr Desig: Corning 430195...
Company:Sigma-Aldrich

E-Gel96 High-Throughput Agarose Electrophoresis System from Invitrogen

Description:...more. Fully automated, robot-compatible, and ready to put into action, the E-Gel 96 system makes your high-throughput screening assignments as easy as plug & Play....
Company:Invitrogen

CHEF-DR III System, 220-240 V from Bio-Rad

Description:...power module, variable-speed pump, 14 x 13 cm casting stand with frame and platform, comb holder, 15-well, 1.5 mm thick comb, screened cap, disposable plug molds, 12 feet of Tygon tubing, 2 plugs S. cerevisiae DNA size standards, two 0.5 A FB fuses, 5 g pulsed field certified agarose, 5 g Certified megaba...
Company:Bio-Rad

More>>

PLUG in Biological Dictionary

Yolk plug

Yolk plug is the remaining patch of endodermal cells that is created during the formation of the ventral lip of the blastopore. It is a patch of large endodermal cells which remains exposed on the vegetal surface of the amphibian blastula that will eventually be internalized by epiboly. ...

Supercoil

...se Assemblies can. be ordered with these reusable compression ... Shop for Super Coil Adapter Harness and Engine Parts at Shop.com. Allows direct plug in into wiring harness coil connector Under Car & Hood|Engine Parts Super Coil ... oakley.com " Footwear " Sandals " SUPERCOIL ™ 2. Get FREE ...

Receptacle

.... Also exporters of wholesale Receptacle . ... Receptacle ---British type ... receptacle ... Replacing a receptacle that no longer holds a plug securely, or replacing an ungrounded... How to Remove the old receptacle and install the new one the ... 1000Bulbs.com offers weatherproof recep...

Mating

...s four pages of pictures of mating dogs including a greyhound page. ... There are many more dog clips on the sites mating DVD's. ... A mating plug in a female Richardson's ground squirrel (Spermophilus richardsonii) ... Mating plugs are used by many species, including Ring-tailed Lemurs, bees, ...

Adapter

...ss your questions with adapter experts. ... Sony Cassette Adapter for MP3, ... For resources and information on Battery and Power adapter ... plug Adapter for all countries, 110V/240V Power converter Transformer. ... Intel® 10 Gigabit AF DA Dual Port Server Adapter . Intel® 10 Gigabit AT Se...
Other TagstransferasetransferaseCaymanCorporationCorporationInstrumentsInstrumentsAbcamHYBHYBHYBHYBHYBAntibodyShopCorpCorpCorpCorpUSBUSB
(Date:12/4/2009)... The renowned Center for mind-body medi...g the only natural immuno-boosting herbal suppleme...rveda. , San Diego, Calif...nprecedented illness due to factors such as stress... millions of people around the world are looking f...
(Date:12/3/2009)... With a membership increase of more tha...ement not only as a milestone in its history, but ...ce. Most associations are experiencing a decline i...o;At a time when trade organizations across the na...experiencing unprecedented growth, signaling that ...
(Date:12/3/2009)...INNEAPOLIS, Dec. 3 Children,s Hosp...cipient of the 2009 Leapfrog Top Hospitals Award. ...ering care that is among the best in the nation wh...y. ,, The Leapfrog survey is the only national,...uding mortality rates for common procedures, infec...
(Date:12/3/2009)...EVERLY HILLS, Calif., Dec. 3 Chris...ivine Design Gala and Premier Shopping Event for P...at 50-70% off regular prices. The event kicks off...December 7, 2009, located at 9900 Wilshire Bouleva...rnia. Please visit www.divinedesign.org for mor...
(Date:12/3/2009)...erforms widely used sulfonylureas, but each patien...RSDAY, Dec. 3 (HealthDay News) -- A class of drug...abetes is associated with a higher risk of dying a...n, researchers say. , , Sulfonylureas, long a m... than metformin in a study of oral anti-diabetes d...
Breaking Medicine News(10 mins):Health News:The Chopra Center for Wellbeing Launches Vedamune: An Ayurvedic Supplement to Support The Immune System 2Health News:Florida Medical Association Marks Record Membership Growth 2Health News:Children's Hospitals and Clinics of Minnesota Receives National Recognition for Quality and Efficiency 2Health News:Christian Audigier Represented at Divine Design for Project Angel Food 2Health News:Diabetes Drugs Go Head-to-Head in Study 2Health News:Diabetes Drugs Go Head-to-Head in Study 3
(Date:12/3/2009)...reef fish can undergo a personality change in warm...gesting that climate change may make some species ...of young damselfish on Australia,s Great Barrier R...ish are either consistently timid, or consistently...ven more marked as water temperatures rise. , A ...
(Date:12/3/2009)... dwellers must be included in the design of the up... a humanitarian crisis, according to a scientist a...Nature , Dr Simon Lewis argues that at least 50% o...hagen, known as REDD (Reducing Emissions from Defo...st dwellers directly, and their property rights as...
(Date:12/3/2009)... leads the world when it comes to investment in en...ing and Physical Sciences Research Council (EPSRC)...needed: "Scientific and engineering research has a...ar power solutions, but more investment is needed ... if we are to meet our carbon emission targets by ...
Breaking Biology News(10 mins):Fish with attitude: Some like it hot 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Research is vital to a cleaner, greener, low carbon future 2Small optical force can budge nanoscale objects 14883 1Small optical force can budge nanoscale objects 14883 2MSC Appoints Linda Lane Senior VP Sales and Marketing 61578 1IEHP Ranks 232 in California Among Medicaid Health Plans 61573 1IEHP Ranks 232 in California Among Medicaid Health Plans 61573 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria