Navigation Links


meteorology in Medical News

David Yap receives Amethyst Award

...articles in the journals Water, Air, & Soil Pollution and Boundary-Layer meteorology , both published by Springer. After completing a master's degree in meteorology at McGill University in 1969, Dr. Yap received his Ph.D. in urban climatolo...

Space sensors shed new light on air quality

... Emissions of gaseous pollutants have increased in India over the past two decades. According to Dr Sachin Ghude of the Indian Institute of Tropical meteorology (IITM), rapid industrialisation, urbanisation and traffic growth are most likely responsible for the increase. Because of varying consumption patterns...

Clearing the Air for 2008 Beijing Olympics

...id Streets, a senior scientist in Argonne's Decision and Information Sciences Division, said, 'Air quality in Beijing in the summertime is dictated by meteorology and topography. Typically, temperatures are high, humidity is high, wind speeds are low, and the surrounding hills restrict venting of pollution. Thus...
meteorology in Medical Technology

First Year Results of the AXA Research Fund: Over Euro 13 Million Allocated for Research in 2008

...jects conducted by world-class scientific teams: Project on the impact of climate change on major flooding in Europe (Institute for meteorology in Berlin) Project dedicated to the study of the impact and dynamics of marine aliens in the context of climate change (Queen's University B...
meteorology in Medical Dictionary

Funnel

...g a small hole or narrow tube at the apex and used to channel the flow of a substance, as into a small-mouthed funnel cloud ( ′fənəl ′klau̇d ) ( meteorology ) The popular term for the tornado cloud, often shaped like a funnel with the small end nearest the The injection of laser pulses into hydrody...
meteorology in Biological News

Troubled waters: Low Apalachicola River flow may hurt gulf fisheries

...k between the river flow variations and offshore fisheries." Morey, Dmitry Dukhovskoy, also of COAPS, and Mark Bourassa, an associate professor of meteorology at FSU, examined the seasonal and year-to-year variability of the river flow caused by changes in precipitation over the watershed encompassing much o...

NSF announces funding for Alaska Region Research Vessel

... and arctic ecosystems. The vessel will be designed to serve scientists in different disciplines, such as those in fisheries, geology, marine biology, meteorology and oceanography. Research in this region is particularly important because of the high productivity of Alaska's continental shelves and the liveli...

International climate change researchers meet, review latest findings

... whose research focuses on climate modeling and the impact of climate change on crops. Jochem Marotzke , director of the Max Planck Institute for meteorology in Hamburg, Germany, whose research focuses on the role of the large-scale ocean circulation in climate and climate change. Ilana Wainer , a mete...

Oxford's Dr. Rosalind Rickaby receives 2009 Rosenstiel Award

...science. It is awarded annually to one individual on a rotating basis for achievements in six broad disciplinary areas: marine geology and geophysics; meteorology and physical oceanography; marine and atmospheric chemistry; marine biology and fisheries; applied marine physics; and marine affairs. This year's awa...

Wallace S. Broecker wins the BBVA Foundation Frontiers of Knowledge Award in Climate Change

...and Education United States); Hans J. Schellnhuber (Postdam Institute for Climate Impact Research - Germany); Bjorn Stevens (Max Planck Institute for meteorology - Germany); and the Spaniards Carlos Duarte (Mediterranean Institute for Advanced Studies, CSIC University of the Balearic Islands) and Sergio Alonso...

AGU journal highlights -- Dec. 31, 2008

... Title: Effects of microphysical drop size distribution on tornadogenesis in supercell thunderstorms. Authors: Nathan Snook and Ming Xue: School of meteorology and Center for Analysis and Prediction of Storms, University of Oklahoma, Norman, Oklahoma, U.S.A. Source: Geophysical Research Letters ( GRL ) p...

Lifecycles of tropical cyclones predicted in global computer model

...ow detailed studies of tropical cyclone genesis and evolution, as well as other weather and climate-related phenomena," says co-author Yuqing Wang, UH meteorology professor and IPRC research team leader. He believes the results will usher in a new era in weather and climate prediction. ...

International Council for Science launches major research program on natural disasters

...r risk management,' said Filipe Domingos Freires Lucio, a member of the ICSU Planning Group and a former Director-General of the National Institute of meteorology of Mozambique, now at the World Meteorological Organization. 'With the predicted impacts of climate change, countries like Mozambique have no alter...

Wetlands restoration not a panacea for Louisiana coast

...f variability in storm surge height along the shore, variability that isn't reflected in current storm impact models. Scientists can measure storm meteorology wind speeds and directions, rainfall and such but until they can measure the ground effects of storm surge, including how far inland the waves are p...

Petascale climate modeling heats up at University of Miami

...edictions, as well as climate change projections. With this boost in computing capabilities, the research team led by Dr. Ben Kirtman, professor of meteorology and physical oceanography at the University of Miami, has developed a novel weather and climate modeling strategy, or "interactive ensembles," specifi...
meteorology in Biological Technology

Local meteorology company accurately predicts Hurricane Dennis landfall

Madison, Wis. - When Hurricane Dennis reached landfall in the Florida Panhandle July 10 th , it was not too surprising a development. Weather Central Inc. , a Madison-based provider of broadcast weather solutions had already forecast almost the exact location two days earlier. On Friday, July...
meteorology in Biological Definition

Gregor Mendel

...s Mendel's Laws of Inheritance . Mendel's attraction to research was based on his love of nature. He was not only interested in plants, but also in meteorology and theories of evolution. Mendel often wondered how plants obtained atypical characteristics. On one of his frequent walks around the monastery, he f...
Other TagsplayersSolomonfilmfilmfilmfilmhonorhonorassistsforecast
(Date:11/25/2009)....25/PRNewswire/-SentinelleMedicalInc.,aleadingmanu...ftwarelaunchesasuiteofnewleadingedgeclinicalapplic...atthisyear,sRadiologicalSocietyofNorthAmerica(RSNA...0,HallA).Theapplicationsleveragetheuniquehighquali...ngcoilsandsupportmultipleimagingmodalitiesformulti...
(Date:11/25/2009)...icalEndorsements,Business,andPressJoinEfforttoEduc...ire/--Onceagain,theNationalBipolarFoundationandthe...heir"Safe,tilStable"program,whichisnowbeingwidelya...order.Today,theNationalBipolarFoundationreceivedap...ailfromtheLt.GovernorofLouisianaMitchLandrieu.TheN...
(Date:11/25/2009)... period was too short to draw definite conclusions...HealthDay News) -- In diabetic patients with block...rence in outcomes at one year whether patients und...British researchers report. , Bypass surgery ha...s with coronary artery disease. However, less inva...
(Date:11/25/2009)...te, CDC sees few signs of trouble with the H1N1 va...y News) -- The ongoing H1N1 swine flu pandemic may... among younger patients, a U.S. health official sa...erious pneumococcal infections around the country,...er for Immunization and Respiratory Diseases at th...
(Date:11/25/2009)...eat colorectal cancer also can reverse a rare stom...herapy for the disease, researchers at Vanderbilt ...rier,s disease causes thickening of the stomach li...as well as anemia and swelling in the feet and ank... risk for gastric cancer. Previously, the only eff...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3Health News:Stenting May Equal Bypass for Diabetic Heart Patients 2Health News:Stenting May Equal Bypass for Diabetic Heart Patients 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2
(Date:11/24/2009)...el action of a remarkable class of ring-shaped pro... the Lawrence Berkeley National Laboratory (Berkel...graphy beamline at the Advanced Light Source (ALS)...expression and replication, and are vital to the s...ious agents, such as the human papillomavirus, whi...
(Date:11/24/2009)... (November 24, 2009) New research on bacterial co...tems reveals predictable temporal patterns, sugges...s markers for monitoring climate change in the pol... Proceedings of the National Academy of Sciences ... the six rivers shifted synchronously over time, c...
(Date:11/23/2009)...ember 23, 2009 - The time of day matters to forest...per produced by a research team led by Professor M...,s vice-principal for research and colleagues in t...t. George campus. , Capitalizing on their prev... the research team examined how poplar trees use t...
Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2Atomic-level snapshot catches protein motor in action 3Atomic-level snapshot catches protein motor in action 4Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Time of day matters to thirsty trees, U of T researcher discovers 2Combo Treatment May Ease Depression After Stroke 53891 1Combo Treatment May Ease Depression After Stroke 53891 2Stroke Doubles Risk of Hip Thigh Fractures 53889 1Stroke Doubles Risk of Hip Thigh Fractures 53889 2Stroke Doubles Risk of Hip Thigh Fractures 53889 3Carnegie donates landmark clones to biology 9509 1Carnegie donates landmark clones to biology 9509 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia