Navigation Links


Bones in Medical News

Slow-Healing Bones May Get Boost From Drug

Full-fledged study will test effect on healing time and pain reduction,,,, TUESDAY, April 14 (HealthDay News) -- A drug that boosts the body's production of stem cells appears to "jump-start" the bone-healing process to a point that older adults' bones heal as fast as young people's, s...

A Little Drink May Be Good for Your Bones

Moderate consumption offers the most protection, study finds,,,, WEDNESDAY, March 18 (HealthDay News) -- Older men and postmenopausal women who have one or two glasses of beer or wine a day appear to have stronger bones than both nondrinkers and heavy drinkers, a new study suggests. ...

Healthy bones program reduces hip fractures by 37 percent

PASADENA,Calif. November 4, 2008 Proactive measures can reduce hip fracture rates by an average of 37.2 percent -- and as much as 50 percent -- among those at risk, according to a study conducted by Kaiser Permanente Southern California. The study was published online on November 3 by The Journa...

The Biology of Broken Bones Leads to New Treatments

Understanding how a fracture heals uncovers "biologic treatments" ROSEMONT, Ill., Nov. 3 /PRNewswire-USNewswire/ -- A review of research into how cells and proteins repair fractured bones published in the November 2008 issue of The Journal of the American Academy of Orthopaedic Surgeons ( ht...

Do Antidepressants Make Bones Brittle?

Studies suggest an increased fracture risk in people who take the medications FRIDAY, July 11 -- (HealthDay News) -- Older adults may get a needed mood boost from a prescribed antidepressant, but they're also at increased risk for bone fractures, a growing number of studies suggest. ...

Good luck indeed: 53 million-year-old rabbit's foot bones found

One day last spring, fossil hunter and anatomy professor Kenneth Rose, Ph.D. was displaying the bones of a jackrabbits foot as part of a seminar at the Johns Hopkins University School of Medicine when something about the shape of the bones looked oddly familiar. That unanticipated eureka moment...

More>>

Bones in Medical Technology

Healthy Bones Program Reduces Hip Fractures by 37 Percent, Kaiser Permanente Study Finds

Largest Study of Its Kind PASADENA, Calif., Nov. 4 /PRNewswire/ -- Proactive measures can reduce hip fracture rates by an average of 37.2 percent -- and as much as 50 percent -- among those at risk, according to a study conducted by Kaiser Permanente Southern California....

Amgen Announces Positive Top-Line Results for Denosumab in Trial for Delay of Skeletal Related Events in Bone Metastases Patients Compared to Zometa(R)

...erious complications for advanced cancer patients. Regardless of the type of underlying cancer, the process by which cancers invade and destroy bones is fundamentally the same. At the center of this destructive process is a protein RANK Ligand that is stimulated by the presence of cancer in the bone...

Economy is Driving Many Osteoporotic Women to Retire Later - But Their Ability to Work May Be Undermined by Sub-Optimal Management of Their Disease

...is Interactive survey commissioned by the Know My bones Council showed (n=889 with PMO; n=912 without PMO...nformation from reliable sources like the Know My bones Council ." National survey results show ma... or broken bones.(19) About the Know My bones Council Guided by the belief that the pa...

R788 in TASKi3 Clinical Trial Does Not Meet Efficacy Endpoints in RA Patients Who Had Previously Failed Biologic Therapies - Results Incongruent

...n blood pressure medications such as ACE inhibitors or diuretics. "For this patient population, patients who failed biologic therapies, their bones and joints appear to respond to R788, but the objective and subjective components of the ACR and DAS28 scores are incongruent, mainly because the repo...

Large, Long-Term Study Shows Avandia Has No Increased Overall Cardiovascular Risk Compared to Other Commonly Used Diabetes Medicines

...e U.S. Prescribing Information for Avandia, including bone fractures, which were higher in the group randomized to Avandia and were seen mostly in the bones of the arm, hands, lower leg and feet, and predominantly in women. Among patients randomized to Avandia, the results for the following prespecif...

Glivec(R) is the First Adjuvant Treatment Approved in the UK to Delay Return of Gastrointestinal Cancer After Surgery

...ed a soft tissue sarcoma i.e. a cancer of a supportive or connective tissue in the body such as fat, muscle, blood vessels, deep skin tissues, nerves, bones and cartilage.(8) GISTs develop primarily along the gastrointestinal tract (digestive system) and often spread within the abdomen.(9) Although ...
Bones in Medical Products

TC-100 Large Fragment Set

Description:...ce, expertise and support that only Smith & Nephew can provide. The TC-100 Large Fragment Set, which is designed for fixation of fractures in large bones such as the humerus, tibia and femur. The Large Fragment Set offers similar implants and instruments to the Small Fragment Set; however, the large fra...
Company:Smith & Nephew, Inc. - Orthopedics

TC-100 Mini Fragment Set

Description:...nce, expertise and support that only Smith & Nephew can provide. The TC-100 Mini Fragment Set, which is designed for fixation of fractures in small bones of the hand and foot. The Mini Fragment Set consists of a single tray with removable instrument, drill bit and screw caddies....
Company:Smith & Nephew, Inc. - Orthopedics

AIM Titanium Humeral Nail System

Description:...ary nailing indications for humeral fractures should be viewed with caution. The anatomy and function of the humerus are quite different from the long bones of the lower extremity. Before choosing humeral nailing, adequate planning should be used to minimize difficulties. Rotator cuff injury, proximal hume...
Company:DePuy Orthopaedics, Inc.

Diamond Carpal Fusion Plates with System Pack Technology

Description:... The Diamond plate is designed for four corner fusion of the capitate, hamate, lunate and triquetrum bones in the hand. The plate is intended for use in patients suffering from pain and/or loss of function due to SLAC and SNAC wrist, post-traumatic arthriti...
Company:Small Bone Innovations, Inc.

Acutrak Standard / Mini

Description:...re used primarily for secure fixation for fractures and fusions of the upper extremity, but have been used for numerous foot and ankle procedures. The bones stabilized with these two systems have ranged from scaphoids to OCDs where there exists significant cartilage surrounding the bones, to phalangeal fus...
Company:Acumed LLC

Biax™ Total Wrist System

Description:...troyed cartilage and insert a joint replacement implant in place of the damaged wrist. Doctors stabilize the implant by cementing its stems inside the bones with bone cement....
Company:DePuy Orthopaedics, Inc.
Bones in Medical Definition

Growth attenuation

... Growth attenuation is an elective medical treatment which involves administering estrogen to cause closure of the epiphyses of the bones , resulting in a reduced adult height. Since the 1960s this treatment has been performed primarily on children growing toward an adult height consider...

Medicine

...eals with medical problems related to work and the working environment. Osteopathic medicine claims that much disease results from problems with bones and joints. Pharmacogenomics is a form of individualized medicine . PanVascular Medicine is an approach to deal with the problems of high...
Bones in Medical Dictionary

Long bones

The long bones are those that are longer than they are wide, and grow primarily by elongation of the diaphysis, with an epiphysis at the ends of the growing bone. The ends of epiphyses are covered with a hyaline cartilage . The longitudinal growth of long bones is a... long bone n. An...

Flat bones

Flat bones are those bones which are found where the principal requirement is either extensive protection or the provision of broad surfaces for muscular attachment, the bones are expanded into broad, flat plates, as in the skull, the pelvis, sternum, rib cage, and the scapula. In contr...

Broken bones

A bone fracture is a medical condition in which there is a break in the continuity of the bone. While many fractures are the result of high force impact or stress, bone fracture can also occur as a result of certain medical... What happens when you break a bone ? ... How Do Broken Bon...

Yaws

... Yaws also Pétasse tropica, thymosis, polypapilloma tropicum, pian or parangi) is a tropical infection of the skin, bones and joints caused by the spirochete bacterium Treponema pallidum pertenue. Other treponemal diseases are... Get the facts on the bacterial ...

Wrist pain

... it is frequently overused and has a complicated anatomy, with many structures packed into a small space. Injuries such as dislocations or broken bones can also cause wrist pain . ... your doctor should tend to immediately—here's how to get a handle on wrist pain . ... But then your wrist ...

Vitamin K

...vitamin K ? ... Vitamin K is absolutely essential to build strong bones and helps promote heart health. ... supply almost half of the vitamin ...ase has been ... Vitamin K reduces the rate of calcium loss from the bones in osteoporosis ... By preventing the blood clots that trigger hea...
Bones in Biological News

Purdue study finds dairy better for bones than calcium carbonate

WEST LAFAYETTE, Ind. - A Purdue University study shows dairy has an advantage over calcium carbonate in promoting bone growth and strength. Connie Weaver, distinguished professor and head of the food and nutrition department, found that the bones of rats fed nonfat dry milk were longer, wider, m...

Building better bones and tissue in the lab

Tissue engineering holds great promise for the treatment of conditions such as arthritis, osteoporosis, fibrosis, periodontal disease and traumatic injuries. However, bone and cartilage currently produced in the laboratory don't have sufficient strength to function in the body so they're not clin...

Bare bones of crystal growth: Biomolecules enhance metal contents in calcite

Blacksburg, Va. From shells to bones, the skeletons of organisms contain small amounts of impurity elements such as magnesium. Because the levels of these elements provide important clues to past environments, a considerable effort has focused on understanding how to relate impurity contents to t...

Excavated Jericho bones may help Israeli-Palestinian-German team combat tuberculosis

Six-thousand year old bones excavated in Jericho may help a joint Israeli-Palestinian-German research group combat tuberculosis. According to Prof. Mark Spigelman of the Kuvin Center for the Study of Infectious and Tropical Diseases at the Hebrew University of Jerusalem, who is leading the Isr...

Ancient fish bones reveal impacts of global warming beneath the sea

Scientists studying ancient fish bones in Scandinavia have discovered that warm-water species like anchovies and black sea bream that once thrived in Danish waters during a prehistoric warm period are now returning. Some cold-water species, such as cod, were also abundant during this period, havi...

New research on structure of bones raises questions for treatment of osteoporosis

Researchers have discovered that the structure of human bones is vastly different than previously believed findings which will have implications for how some debilitating bone disorders are treated. Researchers from the University of Cambridge, the Animal Health Trust in Newmarket, and the BAM...

More>>

Bones in Biological Technology

Scientists identify gene vital to early embryonic cells forming a normal heart and skull

...igrate to specific regions of the embryo. While doing so, the cells are supposed to differentiate and give rise to certain nerve tissues, craniofacial bones or smooth muscle tissue of the heart. "Our findings show that a deficiency of SHP2 in neural crest cells results in a failure of cell differentiati...

TED Conferences Announces 25 TED Fellows for TEDGlobal in Oxford

...ter; political scientist looking at how the Internet influences civic engagement and regime stability Naomi Natale (US) -- Founder, One Million bones and the Cradle Project, socially focused large-scale art installations Alexander Petroff (US/Democratic Republic of the Congo) -- Founder, Work...

NeoStem Obtains Exclusive License to Innovative Stem Cell Procedure Treating Musculoskeletal Diseases

...he individual's own blood, and generates millions of stem cells over two to three weeks. These cells are then re-injected into the person's joints or bones in an office procedure to assist in tissue healing and restoration of bone and cartilage. The Regenexx Procedure has helped many patients avoid more...

Life sticks: UC San Diego bioengineer's sticky insights published in journal Science

...t nevertheless rely on responsiveness to forces for proper function are leg bones and breast acini. Breast acini are hollow spherical objects at the ends of ... systems that respond to forces in a manner similar," said Engler. The long bones of the human skeleton are another example, where their elongated and cylind...

MMR and Dancing Paws to Participate in Joint Sales Effort to Provide Personal Health Records for Pets

...myesafedepositbox.com ), has entered into an agreement with Natural Products For Pets ("NPP") ( www.dancingpaws.com ), a leading manufacturer of Green bones and Pet Nutritional Products, to offer NPP customers a MyMedicalRecords Personal Health Record with the purchase of any NPP, Dancing Paws or Breathali...

Renowned Stem Cell Researcher Files Study Results With Stemedica

... of an on-going, ten year study involving nearly four hundred patients by Dr. Herningou using stem cell therapy and traditional treatment of non-union bones and joints. The Stemedica study results gave clear evidence that the use of adult stem cells provided greater healing capability in a shorter period ...
Bones in Biological Definition

Anatomy

... Ovary Pharynx Pancreas Penis Placenta Rectum Skin Small intestine Spleen Stomach Tongue Uterus bones in the human skeleton : Collar bone (clavicle) Thigh bone (femur) Humerus Mandible Patella Radius Skull Tibia Uln...

Biomechanics

...echanics of Circulation 4 Biomechanics of the bones 5 Biomechanics of the Muscle 6 Viscoelas...and development of limbs , the vasculature , and bones . An understanding of the physiological behavior o...e modeled as a continuum. Biomechanics of the bones ...

Bone

... into which it is formed, found in many animals . bones support body structures, protect internal organs ..., calcium metabolism , and mineral storage . The bones of an animal are, collectively, known as the skeleton . Evolutionary alternatives to bones are shells and chitin . Contents showT...

Brain

... develop from the anterior section of a single dorsal nerve cord , which later becomes the spinal cord . In craniates, the brain is protected by the bones of the skull . Vertebrates are characterized by increasing complexity in the cerebral cortex as one moves up the phylogenetic and evolutionar...

Cancer

...ysis , hepatomegaly (enlarged liver ), bone pain, fracture of affected bones and neurological symptoms. Systemic symptoms : weight loss , poor a...ma - in the pleura or pericardium , oral cancer , osteosarcoma - in bones , ovarian cancer , pancreatic cancer , prostate cancer , renal cell car...

Cartilage

...round substance. Hyaline cartilage is found lining bones in joints (articular cartilage) . It is also prese...d at sites connecting tendons or ligaments to bones . There is rarely any clear line of demarcation be...ed below. Arthritis : The cartilage covering bones in joints (articular cartilage) is degraded, resul...
Bones in Biological Dictionary

Voluntary muscle

...cells of voluntary muscles (those we can move at will, such as the arm ... Voluntary muscle fibers are long and thin, and most of them move bones when they ... Voluntary Muscle . This type of muscle is composed of long fibers surrounded by a membranous sheath, ... Map of Muscle Shoal...

Vertebral column

...l column is composed of a series of 31 separate bones known as vertebrae. ... A curvature of the verteb...umn is a flexible column , formed by a series of bones called vertebrae. ... The coccyx—or tailbone—is th...adult vertebral (spinal) column consists of 26 bones that are grouped as follows: ... congenital defect...

Tibia

... The tibia , shinbone, or shankbone is the larger and stronger of the two bones in the leg below the knee in vertebrates and connects the knee with the ankle bones. Tibia is a massively multiplayer online roleplaying game (...

Thorax

...ia, the free encyclopedia ... Online Shopping at DirectTextBook.com - Save up to 80%, buy or rent. New and used books like Skeletan System Overview bones of the Thorax 4th edition by King from... Thorax information including symptoms, causes, diseases, symptoms, treatments, and other medical and ...

Sutures

.... Sutures are used to close cuts from injuries ... Cranial sutures - Overview, Cranial sutures are fibrous bands of tissue that connect the bones of the skull. ... Feeling the cranial sutures and fontanelles is ... The facial sutures of Asaphiscus run from the anterior of the cephalon to ...

Stapes

...or more. Low prices on office essentials. Staples that was easy. - - stapes n. , pl. stapes or stapedes ( ). The innermost of the three small bones of the middle ear, shaped somewhat like a stirrup ... malleus · incus · stapes ... Stapes ... The stapes or stirrup is the stirrup-shaped sma...
Other TagsplayersSolomonfilmfilmfilmfilmhonorhonorassistsforecast
(Date:11/25/2009)....25/PRNewswire/-SentinelleMedicalInc.,aleadingmanu...ftwarelaunchesasuiteofnewleadingedgeclinicalapplic...atthisyear,sRadiologicalSocietyofNorthAmerica(RSNA...0,HallA).Theapplicationsleveragetheuniquehighquali...ngcoilsandsupportmultipleimagingmodalitiesformulti...
(Date:11/25/2009)...icalEndorsements,Business,andPressJoinEfforttoEduc...ire/--Onceagain,theNationalBipolarFoundationandthe...heir"Safe,tilStable"program,whichisnowbeingwidelya...order.Today,theNationalBipolarFoundationreceivedap...ailfromtheLt.GovernorofLouisianaMitchLandrieu.TheN...
(Date:11/25/2009)... period was too short to draw definite conclusions...HealthDay News) -- In diabetic patients with block...rence in outcomes at one year whether patients und...British researchers report. , Bypass surgery ha...s with coronary artery disease. However, less inva...
(Date:11/25/2009)...te, CDC sees few signs of trouble with the H1N1 va...y News) -- The ongoing H1N1 swine flu pandemic may... among younger patients, a U.S. health official sa...erious pneumococcal infections around the country,...er for Immunization and Respiratory Diseases at th...
(Date:11/25/2009)...eat colorectal cancer also can reverse a rare stom...herapy for the disease, researchers at Vanderbilt ...rier,s disease causes thickening of the stomach li...as well as anemia and swelling in the feet and ank... risk for gastric cancer. Previously, the only eff...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3Health News:Stenting May Equal Bypass for Diabetic Heart Patients 2Health News:Stenting May Equal Bypass for Diabetic Heart Patients 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2
(Date:11/24/2009)...el action of a remarkable class of ring-shaped pro... the Lawrence Berkeley National Laboratory (Berkel...graphy beamline at the Advanced Light Source (ALS)...expression and replication, and are vital to the s...ious agents, such as the human papillomavirus, whi...
(Date:11/24/2009)... (November 24, 2009) New research on bacterial co...tems reveals predictable temporal patterns, sugges...s markers for monitoring climate change in the pol... Proceedings of the National Academy of Sciences ... the six rivers shifted synchronously over time, c...
(Date:11/23/2009)...ember 23, 2009 - The time of day matters to forest...per produced by a research team led by Professor M...,s vice-principal for research and colleagues in t...t. George campus. , Capitalizing on their prev... the research team examined how poplar trees use t...
Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2Atomic-level snapshot catches protein motor in action 3Atomic-level snapshot catches protein motor in action 4Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Time of day matters to thirsty trees, U of T researcher discovers 2Combo Treatment May Ease Depression After Stroke 53891 1Combo Treatment May Ease Depression After Stroke 53891 2Stroke Doubles Risk of Hip Thigh Fractures 53889 1Stroke Doubles Risk of Hip Thigh Fractures 53889 2Stroke Doubles Risk of Hip Thigh Fractures 53889 3Carnegie donates landmark clones to biology 9509 1Carnegie donates landmark clones to biology 9509 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia