Navigation Links


Avian in Medical News

Dove and Early Canada Goose Seasons to Begin Sept. 1; Game Commission Posts Avian Influenza Information on Website

HARRISBURG, Pa., July 10 /PRNewswire-USNewswire/ -- Hunters will see similar dove and early Canada goose seasons and bag limits, both of which open Sept. 1, as part of Pennsylvania's 2009-10 migratory bird seasons announced today by Pennsylvania Game Commission Executive Director Carl G. Roe. ...

iJET Issues 2008 Review & Forecast Report on Avian Influenza and Pandemic Preparedness

Report Demonstrates Need for Continued Pandemic Planning Despite Challenging Economic Climate ANNAPOLIS, Md., March 17 /PRNewswire/ -- iJET Intelligent Risk Systems, a leading provider of global intelligence and business resiliency services, today announced the publication of its annual repo...

New Avian Flu Vaccine Strategy Proposed

Advance shots protect those most exposed in possible pandemic, researchers suggest WEDNESDAY, Oct. 8 (HealthDay News) -- People can be protected against a potential avian flu epidemic by getting advance shots of a vaccine that may or may not be effective against the strain causing th...

Booster vaccination may help with possible future avian influenza pandemic

New evidence suggests that a booster vaccination against H5N1 avian influenza given years after initial vaccination with a different strain may prove useful in controlling a potential future pandemic. The study is published in the August 1 issue of The Journal of Infectious Diseases, now availa...

Penn animal study identifies new DNA weapon against avian flu

PHILADELPHIA - Researchers at the University of Pennsylvania School of Medicine have identified a potential new way to vaccinate against avian flu. By delivering vaccine via DNA constructed to build antigens against flu, along with a minute electric pulse, researchers have immunized experimental a...

iJET Unveils 2007 Year-in-Review Report on Avian Influenza and Pandemic Planning

Report Provides Comprehensive Account of Global Trends, Progress and Preparedness to Assist Organizations with Response Planning ANNAPOLIS, Md., Feb. 12 /PRNewswire/ -- iJET Intelligent Risk Systems, a leading provider of global intelligence and business resiliency services, today annou...

More>>

Avian in Medical Technology

Inverness Medical Innovations Receives USDA Licensure of the BinaxNOW(R) Avian Influenza Virus Type A Antigen Test Kit

WALTHAM, Mass., Aug. 11 /PRNewswire-FirstCall/ -- Inverness Medical Innovations, Inc. (Amex: IMA ), a leading provider of near-patient diagnostics, monitoring and health management solutions, announced today that it has received licensure from the United States Department of Agriculture (USDA...

The New England Journal of Medicine Publishes Study Investigating the Safety and Efficacy of Baxter's Cell-Based Pandemic, Avian Flu Vaccine

First scientific, peer-reviewed publication showing the candidate vaccine induced neutralizing antibodies against widely divergent H5N1 virus DEERFIELD, Ill., June 11 /PRNewswire-FirstCall/ -- Baxter International Inc. (NYSE: BAX ) announced publication in the June 12, 2008 issue of The New E...

Cepheid Announces Termination of Contract With the Centers for Disease Control and Prevention to Develop Rapid Point of Care Test for Avian Influenza

SUNNYVALE, Calif., Sept. 21 /PRNewswire-FirstCall/ -- Cepheid (Nasdaq: CPHD) today announced the termination of its contract with the Centers for Disease Control and Prevention (CDC) for development of a rapid point-of-care diagnostic to detect influenza viruses A and B, and the H5N1 "Avian In...

St. Jude Study Shows Effectiveness of Peramivir in Prevention of Mortality in Mouse Model of Avian Influenza H5N1 Virus Infection

BioCryst Says Study Confirms and Extends Evidence Seen in a Previous Study BIRMINGHAM, Ala., May 02, 2007 /PRNewswire-FirstCall/ -- BioCryst Pharmaceuticals, Inc. today announced that investigators at St. Jude Children's Research Hospital, Memphis, TN, reported favorable results evaluating peramiv...

NanoViricides Drugs Found To Be Highly Effective Against Most Recent Strain of the H5N1 Avian Flu Virus

WEST HAVEN, Conn.--(BUSINESS WIRE)--May 7, 2007 - NanoViricides, Inc. (Pink Sheets: NNVC) presented results of recent animal studies against rabies and BSL3 in vitro studies against a Clade 2 H5N1 (avian influenza) virus at the 23rd Annual Symposium of the Pan American Society for Clinical Virology...

CEL-SCI'S CEL-1000 Shown to Significantly Enhance Immune Response Against Avian Flu Antigen in Animals

VIENNA, Va., May 23, 2007 /PRNewswire-FirstCall/ -- CEL-SCI CORPORATION announces that CEL-1000 increased the immune response against H5 avian influenza antigen in combination with MAS-1, a water-in-oil adjuvant delivery system. These findings were presented on May 23, 2007 by Dr. Daniel Zimmerman...

More>>

Avian in Medical Products

MagMAX™ AI/ND Viral RNA Isolation Kits

Description:...al RNA Isolation Kit (patent pending) is designed for rapid purification of avian Influenza (AI) and / or Newcastle Disease (ND) viral RNA from pharynx / tra...atories for use in their testing protocol for real-time RT-PCR detection of avian Influenza virus and Newcastle Disease virus in clinical samples. ...
Company:Ambion, Inc.

Directigen EZ Flu A+B Test Kit

Features:...r maximum efficiency reimbursement Compatible with a wide variety of transport media, saving time and resources required for validation Detects avian influenza (H5N1) isolates and the A/California/07/2004 strain Convenient room temperature storage Liquid controls included to allow for easy ...
Company:BD Diagnostic Systems
Avian in Medical Dictionary

Virus

...are to help protect your computer from viruses and other security threats, and how to ensure your security software is ... In South Korea, where avian influenza virus subtypes H3N2, H5N1, H6N1, and H9N2 ... virus that causes disease in humans, pigs, horses, and fowl (1) ... Answers how bi...

SARS

...respiratory syndrome . ... We do know that SARS can be spread in respiratory droplets ... Swine flu masks, pig flu mask, bird flu mask, avian flu mask, sars mask from 3M is the leading flu prevention cure method suggeted by WHO, World Health ... Severe acute respiratory synd...

Parrot Fever

... What is parrot fever ? Meaning of parrot fever medical term. What does parrot fever mean? ... Parrot fever , which is referred to as avian psittacosis when it ... Information about parrot fever in the free online English ... parrot fever - an atypical pneumonia caused by a...

Lice

... an order of over 3,000 species of wingless insects; three of which are classified as human disease agents. They are obligate ectoparasites of every avian and most mammalian orders. They are... The head louse is an obligate ectoparasite of humans. Head lice are wingless insects spending their entir...

Influenza

...u, flu symptoms, flu shot, and flu treatment. ... on influenza , avian ... Influenza is a major cause of sickness and death around the world ....re found in a number of species including birds, humans, ... In wild birds, avian influenza viruses are typically, though not ... The flu is a conta...

Antibody

...ew. Organelle Markers Review. Tumor Markers Review ... Specific Antibodies Review. Antibody Applications ... Antibody Therapy ... Archive of avian (chicken) antibody research articles - from Gallus Immunotech ... Chicken Polyclonal Antibody , An Appealing Alternative - eggs, they're not just ....
Avian in Biological News

The challenges of avian influenza virus: Mechanism, epidemiology and control

The latest special issue of S cience in China Series C: Life Sciences focuses on the recent progress in the H5N1-related research field. Early 2009, eight human infection cases of H5N1 highly pathogenic avian influenza (HPAI) virus, with 5 death cases, were reported in China. This again made t...

Shades of 1918? New study compares avian flu with a notorious killer from the past

In the waning months of the First World War, a lethal virus known as the Spanish flu (influenza A, subtype H1N1), swept the United States, Europe and Asia in three convulsive waves. The year was 1918. The ensuing pandemic claimed up to 100 million victims, most of whom succumbed to severe respirat...

Protein 'tubules' free avian flu virus from immune recognition

A protein found in the virulent avian influenza virus strain called H5N1 forms tiny tubules in which it "hides" the pieces of double-stranded RNA formed during viral infection, which otherwise would prompt an antiviral immune response from infected cells, said Baylor College of Medicine researcher...

Genetic evidence for avian influenza movement from Asia to North America via wild birds

Wild migratory birds may be more important carriers of avian influenza viruses from continent to continent than previously thought, according to new scientific research that has important implications for highly pathogenic avian influenza virus surveillance in North America. As part of a multi-...

Solving an avian scourge could also provide benefits to human health

The old adage a bird in hand is worth two in the bush may very well apply to a new vaccine project underway in the lab of ASU School of Life Sciences Professor Roy Curtiss, director of the Center for Infectious Diseases and Vaccinology at the Biodesign Institute. There, associate research scie...

MIT finds key to avian flu in humans

CAMBRIDGE, Mass.--MIT researchers have uncovered a critical difference between flu viruses that infect birds and humans, a discovery that could help scientists monitor the evolution of avian flu strains and aid in the development of vaccines against a deadly flu pandemic. The researchers found ...

More>>

Avian in Biological Technology

Fraunhofer USA Center for Molecular Biotechnology Receives Gates Foundation Grant for Avian Influenza Vaccine Development

NEWARK, Del., Jan. 30 /PRNewswire/ -- The Center for Molecular Biology (CMB) has received an $8.7 million grant from the Bill & Melinda Gates Foundation to support continued development of an avian influenza vaccine that uses transient plant-based technology. CMB will develop vaccines agai...

Cleveland Clinic Recognizes New Strategies for Creating Vaccines for Avian Flu as a Top Ten Medical Innovation for 2009

Novavax uses strategies to create vaccines for avian flu through genetically-engineered virus-like particles (VLPs) ROCKVILLE, Md., Nov. 13 /PRNewswire-FirstCall/ -- Novavax, Inc. (Nasdaq: NVAX ) announced today that its strategy for treating avian flu through genetically-engine...

Vaxart Demonstrates Efficacy of Oral Avian Flu Vaccine in Preclinical Studies

- Using proprietary platform, company develops first orally-administered vaccine to protect against avian influenza in a large-animal model - SAN FRANCISCO, Oct. 24 /PRNewswire/ -- Vaxart Inc., a biotechnology company focused on the development of oral vaccines, today announced positive effic...

Canopus Biopharma and Leading Chinese Researcher Team Up to Treat Avian Influenza, to Prevent Possible Pandemic

LOS ANGELES, California and GUANGZHOU, China, August 12 /PRNewswire-FirstCall/ -- - Major Threat Treatable With StatC(TM); FDA-Approved Drugs to Begin Testing in U.S. Animal Models An internationally renowned avian influenza expert today hailed "encouraging and exciting" results from exper...

Kiwa Bio-Tech Joint Venture to Produce Preventative for Avian Flu

Kiwa Bio-Tech & Hebei Huaxing Pharmaceuticals Co., Ltd form Hebei Kiwa Huaxing Bio-Pharmaceuticals Co., Ltd. BEIJING and CLAREMONT, Calif., May 27 /Xinhua-PRNewswire-FirstCall/ -- Kiwa Bio-Tech Products Group Corporation (OTC Bulletin Board: KWBT) announced entry into a contra...

UW shows why avian flu hasn't spread among humans yet

Although more than 100 people have been infected with the H5N1 avian influenza virus, mostly from close contact with infected poultry, the fact that the virus does not spread easily from its pioneering human hosts to other humans has been a biomedical puzzle. Now, a study of cells in the human r...
Avian in Biological Products

Rabbit Anti-Jun B, phospho (Ser79) Polyclonal Antibody, Unconjugated from Lab Vision

Description:... The c-Jun proto-oncogene was first identified as the cellular homolog of the avian sarcoma virus v-jun oncogene. Jun B and Jun D have been shown to be almost identical to c-Jun in their C-terminal regions, which are involved in dimer...
Company:Lab Vision

M-MLV Reverse Transcriptase from Promega

Description:...pol gene of M-MLV and consists of a single subunit with a molecular weight of 71kDa. The RNase H activity of M-MLV RT is weaker than the commonly used avian Myeloblastosis Virus (AMV) reverse transcriptase....
Company:Promega
Avian in Biological Definition

Antigenic shift

...e Asian Flu pandemic of 1957, the Hong Kong Flu pandemic of 1968, and the Swine Flu scare of 1976. In 2004 , scientists pointed out that the avian influenza virus might undergo an antigenic shift with the human flu virus and cause a global influenza pandemic like the one in 1918 . The term ...

Avian influenza

... avian influenza (also known as bird flu ) is a type of...TocToggle("show","hide") 1 Infection 2 avian influenza in humans 3 Prevention and treatmen...s Infection The causative agent is the avian influenza (AI) virus . AI viruses all belong to t...

Brain

... & Mind Magazine Human and Non-Human Primate Brain Atlases neuroscience wiki BrainInfo for Neuroanatomy Related topics avian pallium Brain damage Coma Human brain Regions in the human brain The Memory-Prediction Framework Persistent vegetative state ...

Extinction

...tion 65 million years ago at the end of the Cretaceous period, is best known for having wiped out the non- feathered dinosaurs , called the non- avian dinosaurs, among many other species. According to a 1998 survey of 400 biologists conducted by New York 's American Museum of Natural History ,...

Lung

...s 1.1 Location 1.2 Human lungs 2 avian lungs 3 Reptilian lungs 4 Amphibian lung...e heart. Human lungs See human lung . avian lungs Birds have a complex but highly efficien... for one breath of air to make its way through the avian respiratory system. ...

Retrovirus

...lular organisms due to the increased chemical stability of DNA. The following genera are included here: Genus Alpharetrovirus ; type species: avian leucosis virus Genus Betaretrovirus ; type species: Mouse mammary tumour virus Genus Gammaretrovirus ; type species: Murine leukeamia vi...
Avian in Biological Dictionary

Vitelline membrane

...of commercial layers (abstract) ... and elasticity of the vitelline membrane is important for both ... Jensen C. Ultrastructural changes in the avian vitelline membrane during embryonic development. ... components of the vitelline membrane of hen's egg. ... vitelline membrane . Guest. ...

Viral oncogene

... Murine Leukemia Viral Oncogene Homolog 1 (ABL1). Suggested uses include: ... oncovirus Any virus that causes cancer. Includes the viruses of avian leukosis , ... If the viral LTRs are close enough to that oncogene , they will upregulate ... This gene, a Kirsten ras oncogene homolog from t...

Reverse genetics

...e manufacture : reverse genetics - The genetically modified hemagglutinin ... Reverse Genetics ... The use of reverse genetics has allowed avian strains ... Information Staff, Agricultural Research Service, USDA. Communicating news and ... Reverse genetics has been developed over the pas...

Purkinje fibers

...e ventricular septum. ... ... contractile myocytes to form Purkinje fibers in ... Purkinje fibers of the cardiac conduction system ... In the avian heart, Purkinje fiber differentiation takes ... This effect was more striking in Purkinje fibers with a Vm reduced by stretch. ... effects...

Pseudoautosomal regions

...es. ... ... in the Sex Chromosomal Pseudoautosomal Region of the Emu, Dromaius novaehollandiae ... Pseudoautosomal regions (PARs) shared by avian Z and W sex chromosomes are ... Pseudoautosomal region : Encyclopedia with 57,945 entries from biotech, medicine & life sciences. ... The ...

Primitive streak

...arg. Embryonic disk. ... The formation of the primitive streak is one of the first signs ... The formation of the primitive streak in early avian development marks the on ... of primitive streak formation, and provides an initial stage in the development of a ... The initial appearance of...
Other TagsplayersSolomonfilmfilmfilmfilmhonorhonorassistsforecast
(Date:11/25/2009)....25/PRNewswire/-SentinelleMedicalInc.,aleadingmanu...ftwarelaunchesasuiteofnewleadingedgeclinicalapplic...atthisyear,sRadiologicalSocietyofNorthAmerica(RSNA...0,HallA).Theapplicationsleveragetheuniquehighquali...ngcoilsandsupportmultipleimagingmodalitiesformulti...
(Date:11/25/2009)...icalEndorsements,Business,andPressJoinEfforttoEduc...ire/--Onceagain,theNationalBipolarFoundationandthe...heir"Safe,tilStable"program,whichisnowbeingwidelya...order.Today,theNationalBipolarFoundationreceivedap...ailfromtheLt.GovernorofLouisianaMitchLandrieu.TheN...
(Date:11/25/2009)... period was too short to draw definite conclusions...HealthDay News) -- In diabetic patients with block...rence in outcomes at one year whether patients und...British researchers report. , Bypass surgery ha...s with coronary artery disease. However, less inva...
(Date:11/25/2009)...te, CDC sees few signs of trouble with the H1N1 va...y News) -- The ongoing H1N1 swine flu pandemic may... among younger patients, a U.S. health official sa...erious pneumococcal infections around the country,...er for Immunization and Respiratory Diseases at th...
(Date:11/25/2009)...eat colorectal cancer also can reverse a rare stom...herapy for the disease, researchers at Vanderbilt ...rier,s disease causes thickening of the stomach li...as well as anemia and swelling in the feet and ank... risk for gastric cancer. Previously, the only eff...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3Health News:Stenting May Equal Bypass for Diabetic Heart Patients 2Health News:Stenting May Equal Bypass for Diabetic Heart Patients 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2
(Date:11/24/2009)...el action of a remarkable class of ring-shaped pro... the Lawrence Berkeley National Laboratory (Berkel...graphy beamline at the Advanced Light Source (ALS)...expression and replication, and are vital to the s...ious agents, such as the human papillomavirus, whi...
(Date:11/24/2009)... (November 24, 2009) New research on bacterial co...tems reveals predictable temporal patterns, sugges...s markers for monitoring climate change in the pol... Proceedings of the National Academy of Sciences ... the six rivers shifted synchronously over time, c...
(Date:11/23/2009)...ember 23, 2009 - The time of day matters to forest...per produced by a research team led by Professor M...,s vice-principal for research and colleagues in t...t. George campus. , Capitalizing on their prev... the research team examined how poplar trees use t...
Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2Atomic-level snapshot catches protein motor in action 3Atomic-level snapshot catches protein motor in action 4Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Time of day matters to thirsty trees, U of T researcher discovers 2Combo Treatment May Ease Depression After Stroke 53891 1Combo Treatment May Ease Depression After Stroke 53891 2Stroke Doubles Risk of Hip Thigh Fractures 53889 1Stroke Doubles Risk of Hip Thigh Fractures 53889 2Stroke Doubles Risk of Hip Thigh Fractures 53889 3Carnegie donates landmark clones to biology 9509 1Carnegie donates landmark clones to biology 9509 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia