Navigation Links


Youngest in Medical News

Survey finds that cosmetic ear surgery has the youngest age of patients

Chicago, IL (June 10, 2009) So many classic childhood movies (Dumbo) and sing-a-longs (Do your ears hang low? Do they wobble to and fro?) emphasize large and protruding ears. But it turns out that having protruding ears is often-times a humiliating feature for a teenager. According to the A...

Survey Finds That Cosmetic Ear Surgery Has the Youngest Age of Patients

CHICAGO, June 10 /PRNewswire-USNewswire/ -- So many classic childhood movies (Dumbo) and sing-a-longs (Do your ears hang low? Do they wobble to and fro?) emphasize large and protruding ears. But it turns out that having protruding ears is often-times a humiliating feature for a teenager. ...

Anesthesia in Youngest Kids May be Linked to Learning Disabilities

Study found having 'gone under' more than once by age 3 seemed to raise risk for problems TUESDAY, March 24 (HealthDay News) -- Children who have had anesthesia two or more times by the age of 3 may be at a higher risk of developing learning disabilities later, new research suggests. ...

Mariner Zac Sunderland Sets Sail on Quest to Become the Youngest to Circumnavigate the Globe Solo

- 16-year-old to promote healthy nutrition in partnership with Produce for Kids, Shuman Produce and Mastronardi Produce; departs from Marina del Rey, Calif. on Saturday, June 14 - MARINA DEL REY, Calif., June 13 /PRNewswire/ -- Zac Sunderland, who at 16 years of age is seek...

Mothers less likely to pursue HPV vaccination for youngest daughters

CINCINNATI Because the first national study of its kind has found that U.S. mothers report they are less likely to vaccinate daughters under age 13 against human papillomavirus virus (HPV), even though the vaccine is recommended for girls at age 11 and 12, its incumbent upon the healthcare communi...

Mothers Less Likely to Pursue HPV Vaccination for Youngest Daughters

Mothers' Intentions Run Counter to CDC Recommendations CINCINNATI, April 30 /PRNewswire/ -- Because the first national study of its kind has found that U.S. mothers report they are less likely to vaccinate daughters under age 13 against human papillomavirus virus (HPV), even though th...

Two-year-old Joins Mensa, Becomes Its Youngest Ever Genius

Georgia Brown could count up to ten, identified colours and even dabbled with French, but it was only when the two-year-old took an IQ test that her soaring brainpower was established. Georgia has an IQ of 152 and has become the youngest female celebrated member of Mensa. The younge...

Meet the Youngest Sex Change Patient

Germany - Meet the youngest sex change patient in the world, with the new name, Kim. Prior to the sex change, he was known as Tim, and was diagnosed to be a transsexual//. Subsequently he was given powerful hormone injections to initiate breast development. Tim had all along desired to be a g...

A ‘Brave’ Toddler-The Youngest Organ Donr

Four generations of his family served in the Indian Army and battled the country’s enemies from across the border. His father being a Sena Medal winner// and with ‘Showrya’ meaning ‘brave’ for a name, it appeared that the baby boy was destined to tread the family path. But a fall from the fi...

Polio Outbreak on Wane: Next Rounds Must Focus on Youngest Children

With this year’s polio outbreak on the wane and excellent coverage during recent pulse polio campaigns, the Independent Expert Advisory Group today advised// the government that the next few pulse polio rounds must effectively reach the youngest and most vulnerable children, who are not being suffi...

More>>

Youngest in Medical Technology

SUNY Youth Sports Institute Convenes Top Experts in NYC Next Week to Present Research & Analysis on Energy Drink Health Impacts

...ps them develop positive and healthy relationships within their youth sports community. By exploring this new beverage category for its effects on our youngest population we are helping to fulfill that mission," said Donovan. Top experts in their respective fields will discuss the chemical makeup of the...

WORLD'S First Robotic Assisted Kidney Transplant Performed at Saint Barnabas Medical Center

...ise in transplant surgery has led him to achieve medical "firsts" in New Jersey regarding transplant surgery, including performing a transplant on the youngest pediatric patient in the state, performing New Jersey's first laparoscopic kidney donation surgery, and performing the state's first isolated pancreas...

Mayo Clinic Study Finds Younger Men With Erectile Dysfunction at Double Risk of Heart Disease

...cent more likely to develop coronary heart disease compared to men without erectile dysfunction. The highest risk of new heart disease was seen in the youngest study participants who had erectile dysfunction. In men 40 to 49 years old when the study began, the number of new cases in men with erectile dysfunct...

Thomson Reuters Study Finds Sharp Increase in Use of Sleep Medications by Young Adults

... 50-percent increase in the use of prescription sleep aids among all adults under age 45 from 1998 to 2006. The most dramatic increase was seen in the youngest segment of the study population, those between the ages of 18 and 24, whose prevalence of use increased from 599 users per 100,000 in 1998 to 1,524 us...

Pediatric Heart Transplants at Montefiore Approved by NY State Department of Health

...genital or acquired heart abnormality in children and adolescents. "By adding pediatric heart transplantation to the full range of care we offer our youngest patients, we better meet the significant health needs of our Bronx community," said Steven M. Safyer, MD, president and CEO, Montefiore Medical Center...
Youngest in Medical Products

HRR Pediatric Matching Kit

Description:...nd instructions. Kit is intended to help prepare a child for subsequent HRR 4th Edition color testing. There are several ways to use the test. For the youngest patients, the parents can borrow the kit and help the child learn the concept of matching and become familiar with the HRR symbols. Once the child has...
Company:Richmond Products, Inc.
Youngest in Medical Dictionary

Delirium

...nction ... nigh-omnipotent aspect of delirium and sanity. Delirium is one of The ... Delirium , known to the Greek culture as Mania, is the youngest of the Endless, ... Delirium is not the same as ... For other uses, see Delirium (disambiguation) ... Without careful assessment, delirium c...
Youngest in Biological News

August 2009 Geology and GSA Today media highlights

...ium isotope (87Sr/86Sr) dates of outcropping limestone, revealing a change in the age of the sediment inside and outside the ring of cenotes, with the youngest sediment deposited inside the ring between about 6 and 2.3 million years ago. The new strontium isotope map of northwestern Yucatan compiled by Gilli ...

2 reproductive factors are important predictors of death from ovarian cancer

...l of which temporarily cause ovulation to cease and reduces the total number of cycles. Furthermore, the researchers determined that those with the youngest age at menarche also had poorer survival. After diagnosis of ovarian cancer, participants whose menarche began before age 12 were more likely to die c...

Bullies have harassed 14 percent of workers over past 6 months

... on temporary contracts being more likely to suffer abuse is also turned on its head. According to the research, "it has been shown that it is not the youngest workers who are most exposed to workplace abuse, but in fact workers with supposedly greater contractual stability" who suffer more from this type of ...

The first DFG research centers to be funded for another four years

... Gttingen were established in 2002 and, following their first positive intermediate evaluation in 2006, will again be reviewed in the coming year. The youngest institution is the "Regenerative Therapies" Research Centre in Dresden, which commenced work in 2006. Four of the total of six Research Centres are, f...

The story of X -- evolution of a sex chromosome

...in each pair has lost genes to become a shadow of its former self, while the two X chromosomes are indistinguishable from each other. The third and youngest sex chromosome is different. The Y is not yet shriveled, though it contains many non-functional genes about half the total that will eventually be l...

M. D. Anderson gives first Margaret Kripke Legend Award to Margaret Foti

...oneers in this area." Foti started at AACR as editorial assistant for the journal Cancer Research. She was promoted four years later, becoming the youngest managing editor of a major scientific journal in the United States. After progressing through several management roles, Foti was named the first execu...

Substantial work ahead for water issues, say scientists at ACS' Final Report briefing

...e first reports came out finding that there was no detectable harm done, it defied previous scientific understanding. So we did our own study. For the youngest children, those under the age of 1.3 years, you saw substantial increases in blood-lead incidence immediately after switching to chloramine." Findi...

January-February GSA Bulletin media highlights

...the new data presented by Uenzelmann-Neben et al. It is difficult to say whether the magmatic activity is an on-going process. Drape structures in the youngest sedimentary unit argue against this. The Oligocene-Miocene represents a period of major change. Bottom current activity then took over as the most imp...

Flu shot protects kids -- even during years with a bad vaccine match

... according to new research published in Pediatrics by the University of Rochester Medical Center. The study looked at children between 6 months (the youngest able to receive the vaccine) and 5 years old in 2003-2004 and 2004-2005. The study found that, even though those years had poor matches between the va...

Mapping a clan of mobile selfish genes

...g. The authors conclude that around 10,000 Alu elements are still capable of jumping around, with 37,000 having at least a low level of activity. The youngest ones were all capable of moving around, and the oldest ones were all inactive. "These results mean that Alu is by far the most abundant class of ju...
Youngest in Biological Technology

The first DFG research centers to be funded for another 4 years

... Gttingen were established in 2002 and, following their first positive intermediate evaluation in 2006, will again be reviewed in the coming year. The youngest institution is the "Regenerative Therapies" Research Centre in Dresden, which commenced work in 2006. Four of the total of six Research Centres are, f...

Canary Foundation's Dr. Sanjiv Sam Gambhir Elected to the National Academies Institute of Medicine

...M for their professional achievements and dedication in the areas of health care, prevention of disease, education, or research. He is also one of the youngest members ever elected to the IOM. "I am deeply honored and humbled by this election to membership," said Dr. Sanjiv Sam Gambhir. "Medicine has such a...

New Aptivus(R) (tipranavir) Oral Solution Approved for Treatment-Experienced Pediatric and Adolescent HIV Patients

...d a viral load of less than 400 copies/mL. The proportion of patients with viral load less than 400 copies/mL tended to be greater (70 percent) in the youngest group of patients, who had less viral resistance at baseline, compared to the older groups (37 percent and 31 percent). Agents approved by the FDA in ...

Cord Blood America in Top 20 in Los Angeles Area Biotech-Biomed Companies

... Thousand Oaks. The business publication lists Cord Blood America with 15 employees and annual revenues topping $6 million. Cord Blood is the second youngest public company on the list of twenty, having gone public in 2003. It was established to allow parents to store umbilical cord blood after birth. Stem ...

Meredith Martin Addy Named One of Top 10 Illinois 'Super Lawyers' for 2008

...recognized patent attorneys in Illinois. In the firm's 90 years, she is the youngest female attorney to achieve partner, the youngest female to sit on the firm's Board of Directors and the youngest female to chair a firm practice group, the Appellate Group. Ms. Addy has ...

Genstruct's Andrea Matthews Selected for Mass High Tech's 'People to Watch Under 30'

... University in 2004. As an undergraduate summer student, she began working at Genstruct as the first full-time female employee for the company and the youngest by more than 10 years. In her role as the manager of Scientific Programs at Genstruct, Ms. Matthews drives the progress of scientific and technology ...

WTN Exclusive Interview: Cory L. Nettles, Secretary of Commerce

...ices to keep him informed, up to date and prepared for the day-to-day challenges he faces. Cory L. Nettles, a 32-year-old Milwaukee native, is the youngest member of Doyle's cabinet. He graduated from Lawrence University in Appleton and the University of Wisconsin Law School. From 1996 to present, Nettles...

Are you ready to play the new talent management game?

.... In terms of demographics, the US workforce over the next ten years will take on an hourglass shape in age distribution wide in the oldest (45+) and youngest (under 30) categories of workers and thin across the middle (31-44). Gender participation will become roughly equal. Immigration will make the workpla...

Life Science: From company creation to growth: Doing business in Wisconsin

...on of genetically modified seed varieties and genetic engineering technologies for livestock. Forest and Paper Biotechnology claims some of Wisconsins youngest bioscience companies, while Food Biotechnology offers some of the oldest. Centers of Excellence The expertise of Wisconsin bioscience companie...

Beware the cold-call job interview

... I am familiar with bad jobs. My youngest brother once took a job selling encyclopedias in California. The job involved wandering through unfamiliar neighborhoods, worrying about making a dail...
Other Tagsnetworknetworknetworknetworkdesigneddesigneddesignedrewardrewardyetyetyetinksinksinkswhaleperformed
(Date:12/6/2009)... ORLEANS, Dec. 6 Blood clotting, or ... bleeding when a blood vessel is injured. Sometimes, ... without an obvious injury or do not dissolve ... presented today at the 51st Annual Meeting of ... practice of using the anticoagulants aspirin and heparin ...
(Date:12/5/2009)... new three-drug combination has shown in a phase 1/2 ... regimen" in the treatment of patients newly diagnosed with ... bone marrow, say researchers from Dana-Farber Cancer Institute. , ... the 66 patients treated with the drug combination in ... good partial response rate" in the phase 2 population, ...
(Date:12/5/2009)... ORLEANS, Dec. 5 Leukemia and myeloproliferative disorders ... presented today at the 51st Annual Meeting of ... treatment options and improved diagnostic methods for patients ... infant acute lymphoblastic leukemia, and myelofibrosis that are ...
(Date:12/5/2009)... effort by the National Association of Certified Professional ... Citizens for Midwifery (CfM), International Center for Traditional ... and the Midwifery Education Accreditation Council (MEAC). ... MAMA Campaign to secure federal recognition of CPMs ...
(Date:12/4/2009)... won the Patient,s Choice Award as the favorite dispensary ... by the online website, www.weedmaps.com. Despite only ... selected Medithrive as the preeminent location for accessing medicinal ... of Medithrive confirms the obvious: a dispensary which caters ...
Breaking Medicine News(10 mins):Health News:Three Anticoagulant Studies May Change Current Medical Practice Including New Data Revealing That Preventative Use of Aspirin and Heparin is Not Effective in Reducing Recurrent, Unexplained Miscarriages 2Health News:Three Anticoagulant Studies May Change Current Medical Practice Including New Data Revealing That Preventative Use of Aspirin and Heparin is Not Effective in Reducing Recurrent, Unexplained Miscarriages 3Health News:Three Anticoagulant Studies May Change Current Medical Practice Including New Data Revealing That Preventative Use of Aspirin and Heparin is Not Effective in Reducing Recurrent, Unexplained Miscarriages 4Health News:Three Anticoagulant Studies May Change Current Medical Practice Including New Data Revealing That Preventative Use of Aspirin and Heparin is Not Effective in Reducing Recurrent, Unexplained Miscarriages 5Health News:Three Anticoagulant Studies May Change Current Medical Practice Including New Data Revealing That Preventative Use of Aspirin and Heparin is Not Effective in Reducing Recurrent, Unexplained Miscarriages 6Health News:Three Anticoagulant Studies May Change Current Medical Practice Including New Data Revealing That Preventative Use of Aspirin and Heparin is Not Effective in Reducing Recurrent, Unexplained Miscarriages 7Health News:Multiple myeloma patients experience high response rate with new 3-drug combination 2Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 2Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 3Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 4Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 5Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 6Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 7Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 8Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 9Health News:AquaNatal Birth Center Gives Away a Waterbirth Package to Celebrate the Successful MAMA Campaign 2Health News:AquaNatal Birth Center Gives Away a Waterbirth Package to Celebrate the Successful MAMA Campaign 3Health News:AquaNatal Birth Center Gives Away a Waterbirth Package to Celebrate the Successful MAMA Campaign 4
(Date:12/4/2009)... Texas AgriLife Research plant physiologist at the Texas AgriLife ... ways to help vegetable plants make a less stressful ... research can aid in the successful production and possibly ... producing high-quality, more adaptive plants that will establish well," ...
(Date:12/4/2009)... Botanic Gardens, Kew and the Natural History Museum believe ... than previously thought, with many commonly grown plants ... being "meat eaters". A review paper, Murderous plants: Victorian ... published today (4 December 2009) in the Botanical ...
(Date:12/4/2009)... heart cells, University of Iowa investigators have shown how ... kinase), disrupts the electrical activity of heart cells. ... was published online Dec. 3 in the journal ... developed great interest in calmodulin kinase II as a ...
Breaking Biology News(10 mins):Texas AgriLife researchers helping 2Texas AgriLife researchers helping 3Texas AgriLife researchers helping 4Scientists think 'killer petunias' should join the ranks of carnivorous plants 2U-Iowa study helps advance heart-related research 2Flu Shots Now Available for 2009 Seasonal Influenza at MD Now Urgent Care Centers in Palm Beach County Florida 55670 1Flu Shots Now Available for 2009 Seasonal Influenza at MD Now Urgent Care Centers in Palm Beach County Florida 55670 2Flu Shots Now Available for 2009 Seasonal Influenza at MD Now Urgent Care Centers in Palm Beach County Florida 55670 3Flu Shots Now Available for 2009 Seasonal Influenza at MD Now Urgent Care Centers in Palm Beach County Florida 55670 4Tarascon Publishing Presents Essential Translation Resource for Healthcare Providers with Non English Speaking Patients 55667 1Tarascon Publishing Presents Essential Translation Resource for Healthcare Providers with Non English Speaking Patients 55667 2Tarascon Publishing Presents Essential Translation Resource for Healthcare Providers with Non English Speaking Patients 55667 3High HIV infection rate among Soweto Township gays 55664 1High HIV infection rate among Soweto Township gays 55664 2
Other Contentstransvaginaltransvaginalattacksattacksattacksattacksattacksattacksattacksischemicischemicischemicischemicischemicischemicrejectionrejectionrejectionrejectionrejectionrejectionrejectiontransplanttransplanttransplanttransplanttransplanttransplanttransplantresectionresectionresectionresectiontransurethraltransurethral