Navigation Links


Tools in Medical News

Diagnostic tools and innovative therapies improve patient prognosis

SAN FRANCISCO, August 2, 2009 The world's top lung cancer specialists, medical professionals and researchers are convening this week in San Francisco, CA for the 13th World Conference on Lung Cancer (WCLC), organized by the International Association for the Study of Lung Cancer (IASLC). Preventio...

GetWellNetwork Introduces Discharge Planning Tools in Latest Version of PatientLife System

BETHESDA, Md., July 15 /PRNewswire/ -- GetWellNetwork, Inc., the leading provider of Interactive Patient Care (IPC) solutions, today announced the release of the PatientLife System(R) 3.5 (PLS 3.5). This latest version of GetWellNetwork's interactive bedside system includes tools focus...

Demand for Short-Term Medical Help Leads to Growth for Travel Nursing Staffing Agency; Prompts Move to New Location and Addition of New Online Tools for Nurses

LUBBOCK, Texas, July 15 /PRNewswire/ -- Trends in the economy and the medical industry have led to a demand for less permanent positions and more temporary assignments. This matches perfectly with an increasing number of medical personnel looking for more flexibility and variety in their care...

New Tools Help Parents Reinforce Anti-Smoking Message

Multi-media approach keeps "no smoking" message relevant and fresh. Greensboro, N.C. (Vocus) July 8, 2009 -- Black-and-white movies, eight-track tapes, cassettes--these things are just antiques to most kids. The youth-smoking-prevention experts at "Real P...

National Autism Association's Family First Program Now Providing Free Tools to Help Combat Autism Divorce Rates

NIXA, Mo., June 16 /PRNewswire-USNewswire/ -- The National Autism Association (NAA) announced today it will provide relationship-coaching tools at no charge to qualifying couples who have a child with autism. In response to the rise in divorce within the autism community, the NAA's Family Fi...

Rollout of New Health Care Provider Tools Creates Meaningful Transactions to Streamline Medical Claims

New tools help Highmark members navigate health insurance PITTSBURGH, June 15 /PRNewswire/ -- Collaboration within the health care system and administrative efficiencies are fundamental elements to any number of today's health care reform proposals in Washington, DC. New tools from Highmark ...

More>>

Tools in Medical Technology

New Computer-Based Tools Will Help Make Best Use of Genetic Breast Cancer Tests

ROCKVILLE, Md., Sept. 22 /PRNewswire-USNewswire/ -- A new federal project, funded by the Agency for Healthcare Research and Quality, will lead efforts to develop, implement and evaluate four computer-based decision-support tools that will help clinicians and patients better use genetic tests to...

New Michael J. Fox Foundation Initiative Will Drive Development of Web-Based Tools to Increase Patient Participation in Parkinson's Clinical Trials

NEW YORK, March 19 /PRNewswire-USNewswire/ -- As part of its ongoing efforts to develop research tools that can speed the availability of life-transforming treatments for Parkinson's disease, The Michael J. Fox Foundation announced the launch of its Web-based Clinical Assessment Program. Under...

Breast Cancer and HER-2/neu: Diagnostic Tools for Targeted Therapy

Michael S. Singer, M.D., Ph.D. Harvard Medical School Contributing Editor With over 200,000 new cases and 40,000 deaths per year, breast cancer undoubtedly qualifies as one of Americas most serious health problems. Recently, efforts to develop early detection methods and more effe...

Appendicitis: Evolving Tools to Diagnose a Classic Disease

Michael S. Singer, M.D., Ph.D. Contributing Editor Appendicitis is a common, potentially lethal condition that affects 7% of individuals sometime in their lives. The condition occurs when the appendix, a blind pouch of intestine at the proximal colon, becomes obstructed by mucus, ...

Bench-Top Centrifuges--Basic Tools for the Small Lab

No matter how elementary or advanced, every clinical laboratory possesses one essential devicea centrifuge. It may be a bench-top or floor model, refrigerated or non-cooled, but this apparatus, because of its unique ability to fractionate liquid specimens by creating spin-induced high g-forces, ha...

DNA Helps Reunite Children With Their Families

...ion, go to http://www.hsc.unt.edu/ About Life Technologies Life Technologies Corporation (Nasdaq: LIFE ) is a global biotechnology tools company dedicated to improving the human condition. Our systems, consumables and services enable researchers to accelerate scientific exploration, dri...
Tools in Medical Products

KeraCel Tools for Corneal Surgery

Description: KeraCel Ophthalmic Products are constructed of a patented high-density formulation of lint-free MEROCEL polyvinyl acetal sponge. Each device is configured to be beneficial to both surgeon and patient, by being absorbent, and yet firm enough to gently manipulate delicate tissues during LASIK and oth...
Company:Medtronic Ophthalmics

Vision Premier Holter System

Description:...oftware features advanced capabilities, including automatic categorization of beats, tachogram review and full-disclosure viewing, providing the tools needed for even the most sophisticated analysis....
Company:Quinton Cardiology Systems, Inc.

IQmark Digital ECG

Description:... of oldstyle, stand-alone ECG machines (even including the cost of the computer), and yet this powerful system packs the most sophisticated diagnostic tools available. Plus, its backed by the service, support and confidence of the Midmark namethe most trusted in the field of medical, surgical and dental ex...
Company:Midmark Diagnostics Group

Universal ECG

Description:...gnostic instrumentation have developed. Burdick's Universal ECG can be interfaced with most EMRs making it the ideal choice for physicians looking for tools to support the transition to a paperless office....
Company:Burdick, Inc.

MedCalc 3000

Description:...medical reference and tool set. MedCalc 3000 encompasses a wide array of pertinent medical formulae, clinical criteria sets and decision tree analysis tools used everyday by clinicians, medical educators, nurses and health care students of all types....
Company:Foundation Internet Services

Portable Drug Companion Pharmacology Suite

Description:...nce to chose from over 5,500 entries, with overdose management, Canadian drug names, OTC and herbal remedies. This "Mini-Suite" of drug references and tools is included in all of the PEPID Suites (ED, PRIMARY CARE PLUS, CRC, RN, RN+ONS and EMS)....
Company:PEPID, LLC
Tools in Medical Definition

Forehead lift

... a lighted camera that displays what it sees under the patient’s skin on a television monitor. [4] Other arms on the Endoscope carry actual surgical tools that perform cutting, or grasping functions. The surgeon watches the television monitor to guide his movements. Yet another advancement to endoscopi...

Telephone Triage

...zed training combined with strong decision support tools are the best approach to telepractice. Potential p...telephones in their offices, seeing that these new tools could help their practices. Initially, physicians ...ethod to cumulatively integrate the new skills and tools (protocols and documentation form) and to simulate...

Unsolved problems in medicine

...le to completely repair lesions in the spinal cord, and other peripheral nerves, with 100% functional recovery? Malaria How can both new and old tools be used to effectively control or eliminate this disease that kills one million people each year? List resources Topic lists ( B...
Tools in Medical Dictionary

Vitamin E

...gh the most common form of vitamin E in the American diet is gamma ... Mayo Clinic offers award-winning medical and health information and tools for healthy living. ... Vitamin E supplements are available in natural or synthetic forms. ... Information on the benefits vitamin e offer...

Vitamin C

...t advice and information on a wide variety of different health-related topics. Mayo Clinic offers award-winning medical and health information and tools for ... The use of vitamin C in the prevention/treatment of the common cold and ... Describes its effects, including its role in the formati...

Vitamin B6

... ... Describes sources, benefits, and the negative effects of large doses. Mayo Clinic offers award-winning medical and health information and tools for healthy living. ... Mild deficiency of vitamin B6 is common. ... Vitamin B6 , also known as pyridoxine, is found in every food in o...

Vitamin B12

...seases, drug interactions, and recommended daily intakes of vitamin B12 . Mayo Clinic offers award-winning medical and health information and tools for healthy living. ... Vitamin B12 is bound to the protein in food. ... A vitamin B12 blood test measures the amount of vitamin B1...

Urination

...ies, diagnostic guides, medical books excerpts online about Urination pain, 201 drug side effect causes. ... familydoctor.org Home > Health tools > Search by Symptom > Urination Problems. Advanced Search ... Pain and difficulty with urination are common conditions in ... Informatio...

Tympanometry

...disorders of the middle ear. Alternative Names ... Tympanometry may reveal any of the following: Fluid ... Tympanometry is one of the greatest tools we have at our disposal. ... Tympanometry is the first of these oto-immittance procedures typically performed ... Tympanometry . Definition. ...
Tools in Biological News

From cars to cancer: UH professor employs auto industry tools for tumor therapy

An effort is under way at the University of Houston to use technologies with origins in the automobile industry to develop new tools that will help doctors and technicians better plan radiation therapy for patients with head and neck cancer. Dr. Ali Kamrani, founding director of the Design and ...

Biologist enhances use of bioinformatic tools and achieves precision in genetic annotation

Jos Luis Lavn Trueba, a graduate in biology and biochemistry from the University of Salamanca (Spain) and currently collaborator in the Genetic and Microbiology Research Group at the Public University of Navarre, has enhanced the use of bioinformatic tools for the identification and annotation of ...

Soybean grant gives researchers tools to unravel better bean

For millennia, people have grown soybeans and turned them into many useful products. But when it comes to understanding why a soybean grows, blooms or produces like it does, researchers are left with unanswered questions. University of Georgia professor Wayne Parrott aims to find the answers w...

NIST, NCI bring web 2.0 tools to nanotechnology standards effort

Federal government and U.S. industry scientists say they are forging ahead with plans for an international, online collaboration to speed up creation of critically needed nanotechnology standards, including the underpinning reference materials and tests that support development of nanotech product...

GEN reports on novel tools for deciphering biological networks

New Rochelle, NY, October 17, 2008Systems biology scientists from diverse areas of research are developing a range of methods to model pathways, interpret data, and derive therapeutic targets from biological networks, reports Genetic Engineering and Biotechnology News (GEN). A major focal point of...

Review article provides tools for the Rosaceae genomics community

Blacksburg, Va. A recent paper published in the journal Plant Physiology provides a comprehensive overview of the genomics tools and resources available for the rapidly growing Rosaceae scientific community. Rosaceae is an economically important group of plants that comprises more than 3,00...

More>>

Tools in Biological Technology

Xennex Inc. Providing Satoris Inc. with Latest GeneCards(R) Tools for Characterization of Protein Biomarkers Associated With Neurological Conditions

CAMBRIDGE, Mass., April 20 /PRNewswire/ -- Xennex Inc. (Xennex) announced today that it is collaborating with Satoris Inc. (Satoris) and has provided Satoris with access to GeneCards(R) and associated proprietary tools, including GeneAlaCart and early access to input from the advanced prototype of...

Frost & Sullivan Recognizes Life Technologies for Excellence in the Life Science Research Tools Industry

MOUNTAIN VIEW, Calif., March 24 /PRNewswire/ -- Based on its recent analysis of the drug discovery technologies market, Frost & Sullivan recognizes Life Technologies with the 2009 North American Frost & Sullivan Company of the Year Award. The company's size, product portfolio breadth, mark...

ETS Laboratories Offers New Process Optimization Tools to the Fuel Ethanol Industry

ETS Laboratories announces the exclusive licensing of DxS Scorpions™ technology to test for contaminant microorganisms that reduce yields in biofuel fermentations. Process optimization and targeted control of contaminant microbes can increase profitability. St. H...

Sigma-Aldrich Enters Into Research Collaboration Program With D-Finitive Cell Technologies, Inc., to Develop Research Tools for Regenerative Medicine

ST. LOUIS, Nov. 25 /PRNewswire-FirstCall/ -- Sigma-Aldrich (Nasdaq: SIAL ) announced today it has entered into a research collaboration program with D-Finitive Cell Technologies, Inc. This collaboration is expected to support the development and commercial offering of 14 products over a two-yea...

Max Planck Institute of Biochemistry Uses MathWorks Tools in Its Quest to Cure Cancer : Institute Accelerates Reconstruction of Key Protein Complexes Using MATLAB and Parallel Computing Toolbox

The MathWorks today announced that the Max Planck Institute of Biochemistry is using MATLAB, Parallel Computing Toolbox, MATLAB Distributed Computing Server, and other MathWorks tools to accelerate its workflow and drastically reduce research and development time. NATI...

DNA2.0 Launches New Website: Enhanced Design and Free Bioinformatics Tools Demonstrate DNA2.0's Customer Focus

DNA2.0, the leading synthetic genomics company, announced today a significant redesign of its web site, including a fresh, appealing new interface, a customer-friendly site navigation, a database of published synthetic gene applications and a revamped Bioinformatics Toolbox that provides visitors...

More>>

Tools in Biological Products

Fingerprinting II Database Sharing Tools from Bio-Rad

Description: Fingerprinting II database sharing tools is an optional module for the Fingerprinting II Basic software package that enables peer-to-peer data exchange over the internet and provides external database access....
Company:Bio-Rad

Goat Anti-Cholesterol Oxidase Polyclonal Antibody, Unconjugated from GeneTex

Description:...e I and type II oxidases and are implicated in bacterial pathogenesis. In addition, they are important as clinical reagents, potential larvicides, and tools in cell biology....
Company:GeneTex

Immunochemistry 2 from Promega

Description:...y-step methods for the measurement of immunologically relevant molecules, the use of antibodies as highly specific analytical probes and as separation tools in fluorescence, blotting and affinity chromatography....
Company:Promega

CoverWell imaging chamber gasket with adhesive, one chamber, 20 mm diameter, 1.0 mm deep *set of 40* from Molecular Probes (Invitrogen)

Description:... CoverWell imaging chamber gasket with adhesive, one chamber, 20 mm diameter, 1.0 mm deep *set of 40* Cell Biology Imaging tools and Accessories Microscope Slide Accessories...
Company:Molecular Probes (Invitrogen)

Oligo Synthesis from Biosearch Technologies

Description:... Since the early 80s Biosearch Technologies has been at the forefront providing advanced oligonucleotide tools to accelerate the discovery and application of genomic information. Whether you need dual-labeled FRET probes and primers or 100 or 100,000 custom oli...
Company:Biosearch Technologies

Genetic Mapping of Disease Genes from Promega

Description:...Edwards and E.A. Thompson (1997) • This volume covers: Linkage in dominant recessive and oligogenic disease, Model free (non-parametric) methods, tools for gene mapping and applications....
Company:Promega
Tools in Biological Definition

Biology

...variation of organisms . In modern research, genetics provides important tools in the investigation of the function of a particular gene, e.g. analysis of...can also apply to human cells. The field of animal physiology extends the tools and methods of human physiology to non-human animal species . Plant phy...

Bioinformatics

...d computational biology is the use of mathematical tools to extract useful information from noisy data pr...stems 2.5 Other applications 3 Software tools 4 See also 4.1 Related fields ...putational biology involves developing statistical tools to separate signal from noise in high-throughp...

Biological tissue

... cells that perform a similar function. The study of tissues is known as histology , or, in connection with disease, histopathology . The classical tools for studying the tissues are the wax block, the tissue stain, and the optical microscope , though developments in electron microscopy , immunofluore...

Biomechanics

...mechanics. By applying the laws and concepts of physics, biomechanical mechanisms and structures can be simulated and studied. Relevant mathematical tools include linear algebra , differential equations , vector and tensor calculus , and computational techniques such as the finite element method. Th...

Brain

...changing their connectivity and sensitivity. More recent work in both neuroscience and artificial intelligence models the brain using the mathematical tools of chaos theory and dynamical systems . Interfacing brains with machines The activity of a brain can be detected by electrodes, raising the ...

Classical genetics

... chromosomes . Linkage maps are still used today, especially in breeding for plant improvement . After the discovery of the genetic code and such tools of cloning as restriction enzymes , the avenues of investigation open to geneticists were greatly broadened. Some classical genetic ideas have been...
Tools in Biological Dictionary

Zinc finger

... Genes, based on Ensembl Version 14, August of 2002 ... Zinc Finger tools provides tools for selecting zinc finger protein (ZFP) target sites and for designin...

Upstream

...oward the source of a stream: paddling upstream . adj. ... Where is the upstream oxygen sensor located on a 1999 Ford Taurus SE ... Processes, tools and programs to help your accounting firm achieve greater success. ... UPSTREAM ACADEMY NETWORK. EMERGING LEADERS ACADEMY. LEADERSKILLS ... Upst...

Transversion

...lthough affecting the 11 nucleotide of the 3' ... These results indicated that the GT transversion at the first position of exon 5 ... ... of tools for the Oracle world: the schema version manager TransVersion (tv), the ... TransVersion (Description: Discuss topics of TransVersion ) - this .....

Transgenic animal

...service core facility of the Roy J. ... Transgenic mice were generated at the University of Iowa Transgenic Animal ... Development of Genetic tools for Transgenic Animals . 19 ... Nuclear Transfer in the Production of Transgenic . Farm Animals . 67 ... Transgenic System, Transgenic Ani...

Transcriptome

...iring, analyzing, and managing complex genetic information for use in biomedical research. ... The transcriptome analyser project aims to provide tools to determine and ... Some papers, using our transcriptome data, have already been published: ... Genome & DNA Sequencing Services, De Novo As...

Transcription factor

...ns in ... Transcription factors are important molecules, usually proteins, involved in ... Transcription factors are one of the most common tools that our cells use to ... Caudal type homeo box transcription factor 1 (CDX1) polyclonal antibody. PAB-10468 ... Transcription factor CP2...
Other TagsFlueFlueFlueFlueActiviActiviActiviActiviActivi
(Date:11/21/2009)...H based medical credentialing software company Int...m a partnerhsip with Amerinet, Inc., the leading h...l help to transform quality care within the health...vember 21, 2009 -- ISG Group, LLC, doing business ...t with Amerinet Inc., a leading national healthcar...
(Date:11/21/2009)...ew Haven Dental Group merges their practice with t..., (PRWEB) November 21, 200...ners Dr. David Gibson, Dr. Dean Cloutier, Dr. John...d their growing practice with that of esteemed col... decided he wanted to retire from dentistry in ord...
(Date:11/20/2009)...v. 20 The American Aca...health care reform legislation released this week ...surance individual coverage mandate. The actuaries...ll minimize adverse selection stemming from more r...e bill. ,, "The individual mandate language sho...
(Date:11/20/2009)..., Nov. 20 Rates of infec...ked in late October, but the pandemic flu virus co... age groups, including the elderly, according to a...E: DGX ), the world,s leading provider of diagno...its most recent Quest Diagnostics Health Trends(TM...
(Date:11/20/2009)....C., Nov. 20 Samuel Gla...efine what it means to be "happy" during the holid...pecialty in family counseling and chair of the Dep...ladding says research shows that it is the pressur... depression during the holidays. ,, That,s why ...
Breaking Medicine News(10 mins):Health News:IntelliSoft Group and Amerinet Inc. Form Partnership to Transform Healthcare Delivery of Quality Patient Safety and Care 2Health News:New Haven Dental Group Expands Their Vision 2Health News:Actuaries to Senate: Strengthen Individual Mandate 2Health News:H1N1 Pandemic May Have Peaked in October in U.S., According to Quest Diagnostics 2Health News:H1N1 Pandemic May Have Peaked in October in U.S., According to Quest Diagnostics 3Health News:Why Holidays Don't Have To Be 'Happy' 2
(Date:11/19/2009)..., Nov. 19 BIO-key Intern... in wireless public safety and finger-based biomet...pecial Shareholder Meeting held today was adjourne...was not present. ,, (Logo: http://www.newscom....an impressive 99.3% of the 35 million votes cast v...
(Date:11/19/2009)...Purdue University scientists have helped identify ...cell wall development in maize, an effort that exp... biomass best suited for biofuels production. , ...professor of plant cell biology, published their f... Plant Physiology on Thursday (Nov. 19). They als...
(Date:11/19/2009)...ives Competitive NIH Director,s T-R01 Award , Spe...rk , Dr. Samie Jaffrey, associate professor of p...mong the first researchers to win a prestigious NI...ional Institutes of Health. Dr. Jaffrey and his co...tion technologies that may some day speed up lab t...
Breaking Biology News(10 mins):BIO-key(R) Provides Update to Special Shareholder Meeting 2BIO-key(R) Provides Update to Special Shareholder Meeting 3Maize cell wall genes identified, giving boost to biofuel research 2Weill Cornell science briefs: November 2009 2Weill Cornell science briefs: November 2009 3Weill Cornell science briefs: November 2009 4Weill Cornell science briefs: November 2009 5Study Details Swine Flu Transmission Rates 55637 1Study Details Swine Flu Transmission Rates 55637 2Study Details Swine Flu Transmission Rates 55637 3Teetotallers more likely to be depressed 55632 1Teetotallers more likely to be depressed 55632 2Scans Shed New Light on Concussions 55629 1Scans Shed New Light on Concussions 55629 2
Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchyme