Navigation Links


Think at Biology News

Shift of weather patterns necessitates rethinking of reforestation methods

Forest landowners can greatly increase the survival rate of pine tree seedlings by changing when and how they plant, according to research conducted here. "Some landowners have had to replant two, three or even four years in a row beca...

Deep thinking: Scientists sequence a cold-loving marine microbe

At home in the deep, dark Arctic Ocean, the marine bacterium Colwellia psychrerythraea 34H keeps very cool--typically below 5° degrees Celsius. How does the bacterium function in this frigid environment? To find out, scientists at The Institute for Genomic Research (TIGR) and collaborators have sequenced and analyzed C. psychrerythraea's genome. That genome analysis, posted in the Proceedi...

Thinking the pain away? Study shows the brain's painkillers may cause 'placebo effect'

Sham painkiller prompts brain to release endorphins, bringing real relief to those in pain The study provides the first direct evidence that the brain's own pain-fighting chemicals, called endo...

New research puts a fresh spin on current thinking of speech evolution in humans

A study, published today in the prestigious journal Nature by Dr. Michael Petrides and colleagues at the Montreal Neurological Institute (MNI) at McGill University, challenges current thinking that speech developed as a result of new structures that evolved in the human brain. Dr. Petrides and colleagues have identified a distinct brain region that controls jaw movements in macaque monkeys that i...

Lateral thinking produces first map of gene transmission

A University of Queensland study mapping the evolution of genes has shed light on the role of gene transfer in bacterial diseases. Dr Robert Beiko, Professor Mark Ragan and Mr Timothy Harlow examined the genomes of 144...

More>>

Think at Biology Products
Think at Biology Technology

Schrage: Don't think of distance learning as just automation

Schrage, a research associate at MIT Media Lab and...

Kanavas thinks personal ID theft bill will pass this year

State Senator Ted Kanavas remains optimistic that his bill requiring notification of electronic data breaches will pass the legislature yet this year. Senate Bill 164, co-authored by Kanavas, R-Brookfield, and Representative Jeff Fitzgerald, R-Horicon, would require companies that keep personal data on customers and clients to notify those people when that data is obtained by unauthoriz...

Got Game makes big claims; can 90 million people think the same?

Authors compiled personal interviews and surveys to give bu...

UW-Madison Chancellor Wiley Challenges State to Think About Universitys Future

MADISON Its the Great (Non)Debate: Can the UW-Madison survive as a public university when public dollars make up a declining share of its budget? Thats the question being posed these days by UW-Madison Chancellor John Wiley, whose believes the universitys role as a catalyst for Wisconsins high-tech, high-growth economy will diminish if state investment in higher education stalls. <b...
Think at Medicine News

Stop and think before you eat

According to researchers at the University in Boston, a person's degree of inhibition when it comes to munching down on snacks and goodies is tied to his or her likelihood of being overweight. The good news is that using some restraint--for example by choosing low-calorie foods--can help people who just can't seem to resist the temptation to eat, according to lead investigator Dr. Susan B. Robert...

A High-Definition Hearing Aid that thinks for you

Hearing loss affects all ages. Standard hearing aids amplify all sounds, which makes hearing one sound difficult. Now, there's a new option say researchers. New, all-digital hearing aids are changing that.// This version of this hearing aid automatically distinguishes between speech and sounds.Audiologists say, "The key reason somebody comes in for a hearing aid is that they find that...

Healthcare Professionals Might Want To Rethink Their Dress Code

A new study shows nearly half the neckties worn by medical staff carry disease-causing bacteria. Researchers sampled the neckties of physicians, // physician assistants, medical students and security personnel at a teaching hospital. Their data confirmed that nearly 50 percent of the neckties worn by the medical staff were contaminated with bacteria. Although there is no evidence to sugg...

Positive Thinking

The Earth, a very minute dot in the cosmic solar system, like its brothers and sisters is made up of atoms, which when join together create molecular structures. //Over the centuries, scientist have come to a common understanding that these molecule structures, though immensely complex in nature have one basic principle that keeps them together, their negative and positive components or charge....

Thinking Could Be Affected Due To Hormone Therapy

Men who receive hormone therapy after treatment for prostate cancer may experience temporary problems remembering visual figures and recalling numbers as quickly as they once did //, according to a new study however other key mental functions, such as verbal skills, naming, visual-motor skills, and skills requiring working memory or sustained attention, were not affected by the treatment....

More>>

Think at Medicine Products
Think at Medicine Technology

From Clinical Cancer Research: Rethinking Therapeutic Cancer Vaccine Trials

PHILADELPHIA, July 3, 2007-- Ongoing therapeutic cancer vaccinetrials have yet to show evidence of vaccines spurring apatient’s immune system to shrink tumors -- yet patients whoreceive these vaccines in trials tend to live longer and respondbetter to subsequent treatment. In the July 1 issue of ClinicalCancer Research, a journal of the American Association for CancerResearch, a te...

Answerthink and LORENZ Life Sciences Group Announce Strategic Alliance for the SAP Life Science Industry

MIAMI--(BUSINESS WIRE)--Jun 21, 2007 - Answerthink, Inc. (NASDAQ:ANSR) announced today that it has formed a strategic alliance withLORENZ Life Sciences Group for the distribution of LORENZ solutionsin North America. Answerthink and LORENZ Life Sciences Group willserve midsize companies by integrating best practice submissionsmanagement solutions into Answerthink's Life Science solutionsbase...

FDA Proposes New Warnings About Suicidal Thinking, Behavior in Young Adults Who Take Antidepressant Medications

ROCKVILLE, Md., May 2, 2007-The U.S. Food and DrugAdministration (FDA) today proposed that makers of allantidepressant medications update the existing black box warning ontheir products' labeling to include warnings about increased risksof suicidal thinking and behavior, known as suicidality, in youngadults ages 18 to 24 during initial treatment (generally the firstone to two months).</p...
Other TagsPertussisPenta
(Date:10/10/2008)...ng point for behavior change, DES MOINES, Iowa, O...,Americans (51 percent) believe there are good thi...r changes are needed, according to the 2008,EBRI H...oday by the,Employee Benefit Research Institute an...derwritten by the Principal Financial Group(R)., ...
(Date:10/10/2008)...dentialing Center (ANCC) has designated Geisinger ...s came via a conference call to hospital administr...and applause., GMC joins an elite group of only 1...n the United States that have achieved Magnet stat...s recognition., "Achieving Magnet designation is ...
(Date:10/10/2008)... blame , , FRIDAY, Oct. 10 (HealthDay Ne...ve diabetes, being depressed was associated with a..., Publishing in the October issue of the Journal...he University of Washington tracked 10,704 Medicar...d diabetes and were enrolled in a disease manageme...
(Date:10/10/2008)...llence in the implementation of electronic health ...agement Systems Society (HIMSS) announces the reci...onal, Ambulatory and Community Health Organization...L (PRWEB) October 10, 2008 -- Honoring excellence ... (EHRs), the Healthcare Information and Managemen...
Breaking Medicine News(10 mins):Health News:Video: Just What the Doctor Ordered: Survey Shows Americans Adopting Healthier Lifestyles 2Health News:Video: Just What the Doctor Ordered: Survey Shows Americans Adopting Healthier Lifestyles 3Health News:Geisinger Medical Center earns prestigious Magnet designation 2Health News:Older Diabetics With Depression Face Higher Death Rate 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 3Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 4Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 5
(Date:10/9/2008)...he IOF World Congress on Osteoporosis 2008, at gre...ober 31, 2008. , To benefit from lower rates an...onehealth.org/wco/2008/homepage.html . Special re...m non-OECD countries and for IOF members. After Oc...r rates, will be possible. , Your chance to hea...
(Date:10/9/2008)...olecular Biology Laboratory (EMBL) have generated ...velopmental blueprint of a vertebrate. With a newl...rst time track all cells for the first 24 hours in...ed into a three-dimensional, digital representatio...nt online issue of Science , grants many new insi...
(Date:10/9/2008)...for life in higher animals, vitamin D, once linked...rosis, is now recognized as a major player in cont...verside,s Anthony Norman , an international exper...gust issue of the American Journal of Clinical N...l for contributions to good health in the adaptive...
(Date:10/9/2008)...search is a cornerstone of Frontiers in Optics 200...ciety (OSA), being held Oct. 19-23 at the Riversid...ill take place alongside Laser Science XXIV, the a...ivision of Laser Science. , Reporters interested... contact Colleen Morrison at 202.416.1437, cmorri...
Breaking Biology News(10 mins):Digital zebrafish embryo provides the first complete developmental blueprint of a vertebrate 2Vitamin D a key player in overall health of several body organs, says UC Riverside biochemist 2Vitamin D a key player in overall health of several body organs, says UC Riverside biochemist 3Where optics meets medicine 2Where optics meets medicine 3Where optics meets medicine 4Where optics meets medicine 5Where optics meets medicine 6Where optics meets medicine 7Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 1Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 2Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 3Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 4Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 5Silicons effect on sunflowers studied 3217 1Silicons effect on sunflowers studied 3217 2National scientific meeting on child mental health at Kentucky 3216 1National scientific meeting on child mental health at Kentucky 3216 2National scientific meeting on child mental health at Kentucky 3216 3Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 1Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 2Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 3Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 4
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia