Navigation Links


Tension at Biology News

Inhaling large amounts of salt can cause hypertension

Mathematical models have become invaluable decision-making tools for public health officials. As demonstrated during the United Kingdom's foot-and-mouth epidemic of 2001, models can be useful in two ways: they can reveal the underlying characteristics of an infection and they can allow the comparison of alternative control measures. Often, however, such models make implicit assumptions that may s...

New lifespan extension genes found

New genes tied to lifespan extension in yeast have been identified by researchers from UC Davis and Harvard Medical School. Drastically reducing calorie intake, or caloric restriction, is known to extend the lifespan of species including yeast, worms and rodents. Previous research linked a gene called Sir2 with lifespan extension due to caloric restriction, but worms and yeast that lack Si...

Researchers develop gene therapy to reverse pulmonary arterial hypertension

A University of Alberta research team has discovered important new information they hope will lead to more effective treatments for pulmonary arterial hypertension (PAH)--a deadly form of high blood pressure in the pulmonary arteries caused by uncontrolled cell growth. Therapies are currently limited for a disease that can lead to heart failure and death within a few years. The researchers...

Enzyme affects hypertension by controlling salt levels in body

An enzyme known to cause hypertension increases blood pressure by activating tiny pores, or channels, in kidney cells that allow increased levels of sodium to be reabsorbed into the blood, researchers at UT Southwestern Medical Center have found. The findings shed light on the underlying mechanisms that cause hypertension, and may also help explain why patients with hypertension linked to salt in...

No link found between caffeine intake and development of hypertension in women

Habitual coffee drinking is not associated with an increased risk of hypertension in women, although an association was found with the consumption of sugared or diet colas, according to a study in the November 9 issue of JAMA. Approximately 50 million people in the United States have hypertension, and the prevalence is increasing, according to background information in the article. Hyperte...

More>>

Tension at Biology Products
Tension at Biology Technology

No word on NASDAQ extension for Merge

Chairman Michael Dunham, joined by interim co-CEOs Brian Pedlar and Robert White, said...
Tension at Biology Dictionary

Primer extension

to which a specific <a hre...
Tension at Medicine News

PRIMARY PULMONARY HYPERTENSION GENE DISCOVERED

The discovery of the gene associated with the inherited form of primary pulmonary hypertension (PPH) by Drs. Jane H. Morse of Columbia University and James A. Knowles of the Columbia Genome Center is indeed a major breakthrough. Their study, funded in part by the National Heart, Lung, and Blood Institute at the National Institutes of Health and published in the September issue of th...

New viewpoint on Hypertension

According to researchers, a new study shows that the distinction between the two blood pressure figures increases the risk of death in kidney patients.// A blood pressure reading always consists of two figures - the systolic reading (top figure) and the diastolic reading (bottom figure). Researchers at University of Texas, now report upon the impact the difference between the two known as pulse p...

Hypertension drugs could lower Disability

According to reseasrches, drugs used to treat hypertension could delay muscle loss and disability in seniors. Dr.Graziano Onder, research associate at University of Hopkins has suggested new, beneficial effects of (Angiotensin Converting Enzyme) ACE-inhibitor //drugs, which are widely used for hypertension, beneficial effects on muscle strength and overall physical performance in older adults. Th...

Preventing 'white coat' hypertension

Researchers at the University of Southampton say that docotors are not the best people to assess blood pressure. White coat hypertension is a well-known problem - it means that your blood pressure //may go up when it's measured by a doctor (the 'white coat') but be lower if a practice nurse measures it, or if you measure it yourself. Researchers in, England, have been looking at the white coat e...

New drug for hypertension

The National Chemical Laboratory (NCL) and Emcure Pharmaceuticals Ltd, a Pune-based company have jointly come out with a new drug for the treatment of hypertension. Announcing this at a press conference here on Thursday,// NCL director Sivaram and Emcure managing director Satish Mehta said the chirally pure S-Amlodipine, a product of their collaborative research, will be a great boon for the pati...

More>>

Tension at Medicine Products

ACE Kinetic Hypertension / Cardiac Evaluation, Cardiovascular 001-KK-ACK4 Angiotensin Converting Enzyme

Description:Angiotensin Converting Enzyme (ACE) is an integral part of the enzymatic cascade leading to the generation of Angiotensin II as well as the degradation of Bradykinin. Found in many different cell types, ACE is primarily located in endothelial cells. ACE is not only an important diagnostic parameter for sarcoidosis and myocardial infarction but is also an important parameter for determining genera...
Company:ALPCO Diagnostics

ACE Kinetic Hypertension / Cardiac Evaluation, Cardiovascular 001-KK-ACK Angiotensin Converting Enzyme

Description:Angiotensin Converting Enzyme (ACE) is an integral part of the enzymatic cascade leading to the generation of Angiotensin II as well as the degradation of Bradykinin. Found in many different cell types, ACE is primarily located in endothelial cells. ACE is not only an important diagnostic parameter for sarcoidosis and myocardial infarction but is also an important parameter for determining genera...
Company:ALPCO Diagnostics

ACE Kinetic Hypertension / Cardiac Evaluation, Cardiovascular 001-KK-ACKX Angiotensin Converting Enzyme

Description:Angiotensin Converting Enzyme (ACE) is an integral part of the enzymatic cascade leading to the generation of Angiotensin II as well as the degradation of Bradykinin. Found in many different cell types, ACE is primarily located in endothelial cells. ACE is not only an important diagnostic parameter for sarcoidosis and myocardial infarction but is also an important parameter for determining genera...
Company:ALPCO Diagnostics

ACTH EIA Hypertension / Cardiac Evaluation, Cardiovascular 021-SDX018

Description:ACTH EIA Hypertension / Cardiac Evaluation, Cardiovascular 021-SDX018...
Company:ALPCO Diagnostics

Troponin I EIA Hypertension/ Cardiac Evaluation 025-BC-1105

Description:Troponin I EIA Hypertension/ Cardiac Evaluation 025-BC-1105...
Company:ALPCO Diagnostics

More>>

Tension at Medicine Technology

Progenics and Wyeth Announce Positive Results from Three-Month Clinical-Extension Study of Subcutaneous Methylnaltrexone for the Treatment of Opioid-Induced Constipation in Patients with Advanced Illness

TARRYTOWN, N.Y. & MADISON, N.J.--(BUSINESS WIRE)--Jun 28, 2007- Progenics Pharmaceuticals, Inc. (NASDAQ: PGNX) and WyethPharmaceuticals, a division of Wyeth (NYSE: WYE), today announcedpositive results from a three-month open-label extension study ofsubcutaneous methylnaltrexone for the treatment of opioid-inducedconstipation (OIC) in patients with advanced illness. The resultsare sched...

Speedel Reports Successful SPP635 Phase IIa Trial in Hypertension

Next Generation Renin Inhibitor to Continue Phase II Profilingin Diabetic Patients BASEL/Switzerland and BRIDGEWATER NJ/USA, 28 June 2007-Speedel(SWX: SPPN) today announced that it has reached another significantmilestone in the development of its family of renin inhibitors withthe successful completion of a Phase IIa proof-of-concept clinicaltrial with SPP635 for the treat...

CytRx Reports Promising Data from Its Open-Label Extension Clinical Trial of Arimoclomol in ALS

LOS ANGELES--(BUSINESS WIRE)--Jun 27, 2007 - CytRx Corporation(NASDAQ:CYTR), a biopharmaceutical company engaged in thedevelopment and commercialization of human therapeutics, todayannounced promising data from the six-month, open-label extensionof its completed Phase IIa clinical trial with arimoclomol in ALSvolunteers. While the clinical trial was not placebo-controlled,arimoclomol at a 1...

Opexa Therapeutics Reports Positive Top-line Data in Phase I/II Extension Trial with Tovaxin for Multiple Sclerosis

THE WOODLANDS, Texas--(BUSINESS WIRE)--Jun 21, 2007 - OpexaTherapeutics, Inc. (NASDAQ:OPXA), a company involved in thedevelopment and commercialization of cell therapies, todayannounced positive top-line data in an open-label Phase I/IIextension clinical trial of the investigational T-cell vaccine,Tovaxin(TM), for multiple sclerosis (MS). In this one-year,8-subject extension clinical trial...

Hypertension Vaccine CYT006-AngQb Achieves Strong Blood Pressure Reduction During Important Early Morning Period When Most Adverse Cardiovascular Events Occur

- Blood pressure reduction achieved at 8 am versus placebo: - 25/ - 13 mm Hg (systolic / diastolic, p - Blood pressure reduction dependent on vaccine dose and inducedantiangiotensin II antibody levels - Detailed results presented today at the Seventeenth EuropeanMeeting on Hypertension in Milan, Italy SCHLIEREN (Zurich), Switzerland and MILAN, Ita...

More>>

Tension at Medicine Dictionary

Tension pneumothorax

that requires immediate <a href="/ ?q=/ Medicin...

Tension headache

Full art...

Mixed tension migraine

MLD (Metachromat...

Malignant hypertension

of the optic <a href="/ ?q=/ Medicine-Dict...

Hypotension

is especially common in older adults who...

More>>

Other TagsPertussisPenta
(Date:10/10/2008)...ng point for behavior change, DES MOINES, Iowa, O...,Americans (51 percent) believe there are good thi...r changes are needed, according to the 2008,EBRI H...oday by the,Employee Benefit Research Institute an...derwritten by the Principal Financial Group(R)., ...
(Date:10/10/2008)...dentialing Center (ANCC) has designated Geisinger ...s came via a conference call to hospital administr...and applause., GMC joins an elite group of only 1...n the United States that have achieved Magnet stat...s recognition., "Achieving Magnet designation is ...
(Date:10/10/2008)... blame , , FRIDAY, Oct. 10 (HealthDay Ne...ve diabetes, being depressed was associated with a..., Publishing in the October issue of the Journal...he University of Washington tracked 10,704 Medicar...d diabetes and were enrolled in a disease manageme...
(Date:10/10/2008)...llence in the implementation of electronic health ...agement Systems Society (HIMSS) announces the reci...onal, Ambulatory and Community Health Organization...L (PRWEB) October 10, 2008 -- Honoring excellence ... (EHRs), the Healthcare Information and Managemen...
Breaking Medicine News(10 mins):Health News:Video: Just What the Doctor Ordered: Survey Shows Americans Adopting Healthier Lifestyles 2Health News:Video: Just What the Doctor Ordered: Survey Shows Americans Adopting Healthier Lifestyles 3Health News:Geisinger Medical Center earns prestigious Magnet designation 2Health News:Older Diabetics With Depression Face Higher Death Rate 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 3Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 4Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 5
(Date:10/9/2008)...he IOF World Congress on Osteoporosis 2008, at gre...ober 31, 2008. , To benefit from lower rates an...onehealth.org/wco/2008/homepage.html . Special re...m non-OECD countries and for IOF members. After Oc...r rates, will be possible. , Your chance to hea...
(Date:10/9/2008)...olecular Biology Laboratory (EMBL) have generated ...velopmental blueprint of a vertebrate. With a newl...rst time track all cells for the first 24 hours in...ed into a three-dimensional, digital representatio...nt online issue of Science , grants many new insi...
(Date:10/9/2008)...for life in higher animals, vitamin D, once linked...rosis, is now recognized as a major player in cont...verside,s Anthony Norman , an international exper...gust issue of the American Journal of Clinical N...l for contributions to good health in the adaptive...
(Date:10/9/2008)...search is a cornerstone of Frontiers in Optics 200...ciety (OSA), being held Oct. 19-23 at the Riversid...ill take place alongside Laser Science XXIV, the a...ivision of Laser Science. , Reporters interested... contact Colleen Morrison at 202.416.1437, cmorri...
Breaking Biology News(10 mins):Digital zebrafish embryo provides the first complete developmental blueprint of a vertebrate 2Vitamin D a key player in overall health of several body organs, says UC Riverside biochemist 2Vitamin D a key player in overall health of several body organs, says UC Riverside biochemist 3Where optics meets medicine 2Where optics meets medicine 3Where optics meets medicine 4Where optics meets medicine 5Where optics meets medicine 6Where optics meets medicine 7Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 1Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 2Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 3Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 4Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 5Silicons effect on sunflowers studied 3217 1Silicons effect on sunflowers studied 3217 2National scientific meeting on child mental health at Kentucky 3216 1National scientific meeting on child mental health at Kentucky 3216 2National scientific meeting on child mental health at Kentucky 3216 3Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 1Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 2Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 3Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 4
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia