Navigation Links


TCA at Biology News

TCA at Biology Products

ScriptCap m7G Capping System from EPICENTRE Biotechnologies

Description:ScriptCap™ m7G Capping system features the Vaccinia capping enzyme and all of the components needed to produce a Cap 0 on the end of di- or triphosphate RNA transcripts. These kits feature high efficiency capping (virtually 100%) at a significantly better price than competitive capping enzymes....
Company:EPICENTRE Biotechnologies

ScriptCap 2'-O-Methyltransferase from EPICENTRE Biotechnologies

Description:The ScriptCap™ 2'-O-Methyltransferase converts Cap 0 (or Cap 0-like) RNA into Cap 1 mRNA. The Cap 1 structure has been shown to increase in vivo translation efficiency by up to 50%. This improvement is seen in Cap 0 structures created by the ScriptCap™ m7G Capping System as well as those Cap 0 structures created using standard and ARCA cap analogs....
Company:EPICENTRE Biotechnologies
TCA at Biology Technology
TCA at Medicine News

Smartcard Legislation Fails The Privacy Test - AMA

AMA President, Dr Mukesh Haikerwal, today urged Federal MPs to vote against the Government’s proposed Health and Social Services Access Card //(Smartcard) legislation because it fails to offer adequate protection of private information and discriminates against younger Australians. Dr Haikerwal said the AMA recognizes and supports the potential benefits of the Access Card but is dism...
TCA at Medicine Products

FX miniRAIL RX PTCA Catheter

Description:Think outside the balloon. The first outside-the-balloon, dual-wire dilatation catheter. The FX miniRAIL RX PTCA Catheter represents an innovative new approach to dilatation. Its unique, dual-wire design concentrates stress along the two wires to create expansion planes at low inflation pressures, facilitating dilatation of challenging lesions. The FX miniRAIL RX PTCA Catheter is indicat...
Company:Guidant Corporation

RetCam II Wide-Field Digital Pediatric Retinal Imaging System

Description:The RetCam II is a mobile, self-contained system that can be easily moved around the hospital or office. It provides state-of-the-art Wide-Field Pediatric Retinal Imaging. In just a few minutes you can do an entire exam and document almost the entire retina with as few as 5 photos. The heart of the RetCam II is our 3 CCD medical grade digital camera. Combined with our family of lenses, you can...
Company:Clarity Medical Systems, Inc.

Lyphochek Benzo/TCA Control Set B

Description:Lyphochek Benzo/TCA Control Set B is ideal for monitoring HPLC methods for identification and quantitation of benzodiazepines and antidepressant drugs....
Company:Bio-Rad Laboratories

Lyphochek Benzo/TCA Control Set A

Description:Lyphochek Benzo/TCA Control Set A is ideal for monitoring HPLC methods for identification and quantitation of benzodiazepines and tricyclic antidepressant drugs....
Company:Bio-Rad Laboratories

PCA Professional™ TCA Peels

Description:Trichloroacetic acid (TCA) peels are often thought of as very aggressive and producing substantial discomfort. PCA Professional™ TCA peels are very different from the standard. Our TCA solutions are blends formulated with many ingredients including lactic acid, ascorbic acid (vitamin C), plumping phytohormones and kojic and azelaic acids to produce dramatic results without the discomfort an...
Company:PCA Advanced Skin Care Systems

More>>

TCA at Medicine Technology
Other TagsPertussisPenta
(Date:10/10/2008)...ng point for behavior change, DES MOINES, Iowa, O...,Americans (51 percent) believe there are good thi...r changes are needed, according to the 2008,EBRI H...oday by the,Employee Benefit Research Institute an...derwritten by the Principal Financial Group(R)., ...
(Date:10/10/2008)...dentialing Center (ANCC) has designated Geisinger ...s came via a conference call to hospital administr...and applause., GMC joins an elite group of only 1...n the United States that have achieved Magnet stat...s recognition., "Achieving Magnet designation is ...
(Date:10/10/2008)... blame , , FRIDAY, Oct. 10 (HealthDay Ne...ve diabetes, being depressed was associated with a..., Publishing in the October issue of the Journal...he University of Washington tracked 10,704 Medicar...d diabetes and were enrolled in a disease manageme...
(Date:10/10/2008)...llence in the implementation of electronic health ...agement Systems Society (HIMSS) announces the reci...onal, Ambulatory and Community Health Organization...L (PRWEB) October 10, 2008 -- Honoring excellence ... (EHRs), the Healthcare Information and Managemen...
Breaking Medicine News(10 mins):Health News:Video: Just What the Doctor Ordered: Survey Shows Americans Adopting Healthier Lifestyles 2Health News:Video: Just What the Doctor Ordered: Survey Shows Americans Adopting Healthier Lifestyles 3Health News:Geisinger Medical Center earns prestigious Magnet designation 2Health News:Older Diabetics With Depression Face Higher Death Rate 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 3Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 4Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 5
(Date:10/9/2008)...he IOF World Congress on Osteoporosis 2008, at gre...ober 31, 2008. , To benefit from lower rates an...onehealth.org/wco/2008/homepage.html . Special re...m non-OECD countries and for IOF members. After Oc...r rates, will be possible. , Your chance to hea...
(Date:10/9/2008)...olecular Biology Laboratory (EMBL) have generated ...velopmental blueprint of a vertebrate. With a newl...rst time track all cells for the first 24 hours in...ed into a three-dimensional, digital representatio...nt online issue of Science , grants many new insi...
(Date:10/9/2008)...for life in higher animals, vitamin D, once linked...rosis, is now recognized as a major player in cont...verside,s Anthony Norman , an international exper...gust issue of the American Journal of Clinical N...l for contributions to good health in the adaptive...
(Date:10/9/2008)...search is a cornerstone of Frontiers in Optics 200...ciety (OSA), being held Oct. 19-23 at the Riversid...ill take place alongside Laser Science XXIV, the a...ivision of Laser Science. , Reporters interested... contact Colleen Morrison at 202.416.1437, cmorri...
Breaking Biology News(10 mins):Digital zebrafish embryo provides the first complete developmental blueprint of a vertebrate 2Vitamin D a key player in overall health of several body organs, says UC Riverside biochemist 2Vitamin D a key player in overall health of several body organs, says UC Riverside biochemist 3Where optics meets medicine 2Where optics meets medicine 3Where optics meets medicine 4Where optics meets medicine 5Where optics meets medicine 6Where optics meets medicine 7Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 1Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 2Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 3Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 4Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 5Silicons effect on sunflowers studied 3217 1Silicons effect on sunflowers studied 3217 2National scientific meeting on child mental health at Kentucky 3216 1National scientific meeting on child mental health at Kentucky 3216 2National scientific meeting on child mental health at Kentucky 3216 3Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 1Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 2Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 3Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 4
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia