Navigation LinksBiology NewsHealth NewsBiology TechnologyMedicine Technology


We're sorry, that page (http://www.bio-medicine.org/tag/TASS/) was not found.

Search tass at Google

Search tass at Yahoo

Search tass at Bing

Google
 
(Date:11/24/2016)... Nov. 23, 2016 Cercacor today introduced Ember ... their trainers non-invasively measure hemoglobin, Oxygen Content, ... and Respiration Rate in approximately 30 seconds. Smaller than ... and immediate access to key data about their bodies ... training regimen. Hemoglobin carries oxygen to ...
(Date:11/21/2016)... VILNIUS, Lithuania , Nov. 21, 2016 /PRNewswire/ ... identification and object recognition technologies, today announced that ... for smart cards was submitted for the ... and successfully passed all the mandatory steps of ... III evaluation is a continuing test of fingerprint ...
(Date:11/17/2016)... 17, 2016  AIC announces that it has just released a new white paper ... high-performance scale-out plus high speed data transfer storage solutions. Photo - ... ... ... Setting up a high performance computing or HPC ...
Breaking Biology News(10 mins):
(Date:12/2/2016)... ... December 02, 2016 , ... The ... Waikiki Beach Resort and Spa in Honolulu, offering local frontline clinicians the opportunity ... management. , The demand for supplemental training related to pain management has ...
(Date:12/2/2016)... ... 02, 2016 , ... Rijuven Corp launches rejiva ( http://www.rejiva.com ), a unique ... other wearable health technology on the market can deliver all that rejiva can. , ... insights about their health than the usual heart rate and steps taken”, adds Evens ...
(Date:12/2/2016)... ... 02, 2016 , ... Clarify Health Solutions, Inc., the leading ... in an initial round of funding. The round was led by experienced investors ... receive far better care through the application of the best technologies from other ...
(Date:12/2/2016)... , ... December 02, 2016 , ... ... Laboratory Scientist & Author of Type 2 Diabetes: The Owner’s Manual, http://realtimepressrelease.com/press-releases-tagged-with/daryl-wein ... Sharon Kleyne Hour Power of Water, Global Climate Change and Your Health radio ...
(Date:11/30/2016)... ... November 30, 2016 , ... Northridge ... in-house dental plan for all patients. Understanding that budget can play a part ... a number of perks, including discounts on many valuable dental treatments. Options for ...
Breaking Medicine News(10 mins):
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products:
Shielding's Standard Coat Apron with open back allows for freedom of movement, maximum flexibility and increased comfort....
Upper arm protection...
Light and comfortable thyroid protection. The softest, most comfortable throid collar made. No neck irritating binding....
... full protection is necessary, the Two-Piece ... add to your comfort through more ... greater flexibility. The vest comes with ... hanging loops as well as an ...
Medicine Products:
(Date:11/30/2016)... , Nov. 30, 2016 /PRNewswire/ - Portage Biotech Inc. ... Exchange: PBT.U), is excited to announce the formation ... on developing preclinical ophthalmology assets through proof of ... anti-inflammatory created by Portage Pharmaceuticals Limited and being ... ocular surface and anterior segment diseases. This agent ...
(Date:11/30/2016)...  Tempus, a technology company focused on supporting ... Cancer Center have partnered to better determine which ... treatment based on next generation genomic and transcriptomic ... research collaboration, Tempus will provide sequencing and analysis ... to Penn. Utilizing next-generation sequencing, machine learning and ...
(Date:11/30/2016)... --  Merck , a leading science and technology company, ... of agreements with Evotec AG, whereby Evotec AG will ... such as CRISPR and shRNA libraries. Combining access to ... pathway to explore and identify new drug targets. ... targets, a process that can be time- and labor-intensive," ...
(Date:11/30/2016)... Park, North Carolina (PRWEB) , ... November 30, 2016 , ... ... approved the names and symbols for four elements: nihonium (Nh), moscovium (Mc), tennessine ... a 5-month period of public review, the names earlier proposed by the discoverers have ...
Breaking Biology Technology:
(Date:12/2/2016)... December 2, 2016 bioLytical Laboratories, ein Weltführer bei ... den Mitgliedern des Apothekenbundes von Kenia eingeführt. ... ... INSTI HIV Self Test! (PRNewsFoto/bioLytical Laboratories) ...      (Photo: http://photos.prnewswire.com/prnh/20161201/444905 ) bioLytical ...
(Date:12/2/2016)... Orthopedic Implants (Including Spinal Implants, Reconstructive Joint Implants, ... Significant Market Share Owing to a Large Global Baby Boomer ... ... According to a new report by Persistence Market Research titled ... Type Segment Projected to Witness a Significantly High CAGR Through ...
(Date:12/2/2016)... , December 2, 2016 On ... trading session in red, while the Dow Jones Industrial Average ... the close of US markets, which prompted Stock-callers this morning ... NuVasive Inc. (NASDAQ: NUVA ), Smith & Nephew ... NXTM ), and Cesca Therapeutics Inc. (NASDAQ: ...
Breaking Medicine Technology: