Navigation Links


supports at Biology News

New evidence supports century-old theory of cancer spread

A Yale School of Medicine study in the December issue of Lancet Oncology challenges mainstream oncology researchers to consider tumor cell hybridization with white blood cells as a major reason that cancer metastasizes or spreads to other parts of the body. "Cancer cells exhibit a remarkable number of traits normally attributed to white blood cells known as macrophages, including the abili...

Slow-frozen people? Latest research supports possibility of cyropreservation

The latest research on water - still one of the least understood of all liquids despite a century of intensive study ?seems to support the possibility that cells, tissues and even the entire human body could be cyropreserved without formation of damaging ice crystals, according to University of Helsinki researcher Anatoli Bogdan, Ph.D. He conducted the study, scheduled for the July 6 issue...

Study supports 'urgent' need for worldwide ban on lead-based paint

Environmental and occupational health experts at the University of Cincinnati (UC) have found that major countries--including India, China and Malaysia -- still produce and sell consumer paints with dangerously high lead levels. The researchers say that this l...

Wild vs. lab rodent comparison supports hygiene hypothesis

In a study comparing wild rodents with their laboratory counterparts, researchers at Duke University Medical Center have found evidence that may help to explain why people in industrialized societies that greatly stress hygiene have higher rates of allergy and autoimmune diseases than do people in less developed societies in which hygiene is harder to achieve or considered less critical. T...

UWM brain research supports drug development from jellyfish protein

With the research support from the University of Wisconsin-Milwaukee, a Wisconsin biotech company has found that a compound from a protein found in jellyfish is neuro-protective and may be effective in treating neurodegenerative diseases. Testing of aequorin has yielded promising results, said Mark Y. Underwood of Quincy Bioscience located in Madison. Researcher James Moyer, Jr., an assist...

More>>

supports at Biology Products
supports at Biology Technology

Computer Card Supports Solo Doctor

Oconomowoc, WI-Patrick O'Malley, D.O. established his practice, O'Malley Family Medicine, in Oconomowoc, Wis. (outside Milwaukee) in 2001.He envisioned that practicing ndependently would enable him to provide personalized care to his patients. But, how can a solo practitioner build a thriving practice in today's healthcare industry? "Keeping my overhead low is essential," says O'Malley. "That's w...

CDW buyer supports Berbee growth plans

In a conference call with investors, CDW chief exe...

Tech center supports energy-saving device for heat-treating plants

The funds will suppor...

Inacom Supports Blackhawk Technology Mentor Program

Madison, Wis. -- , located in Janesville, Wis. The program is designed to provide a comprehensive experience for s...

Federal Funding Supports Small Business Innovation

MADISON, WI. -The SBIR/STTR Annual Conference, held June 19 th at the Crowne Plaza in Madison, addressed small businesses that compete for federal research and development funding, in the form of grants and contracts. The major topics ranged from intellectual property rights and protection to preparing cost proposals for applications to developing the commercial possibilities of technological inn...
supports at Medicine News

Vitamin E supports Female Hearts

According to a new study in the American Journal of Clinical Nutrition it was observed that vitamin E may play an important role in preventing the build up of plaque in the arteries that can lead to cardiovascular disease.// Research has shown antioxidant vitamins can protect against the formation of plaque in the arteries. However, most studies have concentrated on people who were alr...

Injection supports Heart Devices

According to a new study a clot-buster injection may unclog a mechanical heart pump, reconditioning the blood flow. Markus Rothenburger, M.D., researcher from University Hospital in Germany,// felt that this is a simple solution to a very serious problem for heart failure patients who receive left ventricular assist devices. A left ventricular assist device is a mechanical pump-like d...

Study supports vegetable diet

A vegetarian diet high in soluble fibre and low in saturated fats can lower bad cholesterol as effectively as some commonly prescribed drugs, a new study found, suggesting medication-free cholesterol control may be viable for some people. Researchers from the University of Toronto showed that a diet heavy in okra, eggplant, soy proteins, oatmeal //and almonds resulted in a 28.6 per cent r...

Study supports century-old cancer theory

A Yale study recommends that oncology researchers consider the 100-year-old theory that tumor cell hybridization with white blood cells as a major reason cancer metastasizes.// 'Cancer cells exhibit a remarkable number of traits normally attributed to white blood cells known as macrophages, including the ability to migrate to lymph nodes and distant organs and to form a new blood supply...

Google Supports Indian's Novel Literacy Drive

An Indian project meant to strengthen reading skills among neo-literates in a cost-effective manner has found favour with the Google Foundation. // "This is not just any corporation supporting the Same Language Subtitling (SLS) project. It's Google!" exclaimed Ahmedabad-based academic Brij Kothari. The US-educated Kothari, who teaches at the Indian Institute of Management, Ahm...

More>>

supports at Medicine Products
supports at Medicine Technology

Major New Review Supports the Broader Potential of CeNeS COMT Inhibitor Discovery Programme

CAMBRIDGE, U.K. 2nd July 2007 - CeNeS Pharmaceuticals (AIM:CEN)("CeNeS" or "the Company") the Cambridge-based biopharmaceuticalcompany today announced that a paper published this week in CNSDrugs(1) further supports the hypothesis that acatechol-O-methyltransferase (COMT) inhibitor that acts in thebrain would be a useful agent to address profound cognitivedeficits in schizophrenia and bi...

Infertile Voice Supports Stem Cell Research: RESOLVE Calls for Patient Options in Using Frozen Embryos

New survey shows more than half of infertile couples willing todonate unused embryos for stem cell research BETHESDA, Md., June 20, 2007 /PRNewswire/ -- RESOLVE: TheNational Infertility Association issued the following statementtoday, in anticipation of President Bush's veto of federallegislation that would loosen current limitations on stem cellresearch: "President Bush is choosin...

Data Showing that ReGen's Colostrinin Supports Healthy Cognitive Function Presented at the 2007 International Congress on Natural Medicine in Australia

London, UK, June 11, 2007-ReGen is pleased to announce thata review of scientific and clinical information on Colostrinin, itsnutraceutical product which the Company believes has the potentialto support healthy cognitive function, was presented today at the2007 International Congress on Natural Medicine in SurfersParadise, Queensland, Australia by Dr Marian Kruzel, ReGen's ChiefScientifi...

Independent publication supports the profile of CeNeS phase II compound, CNS 5161

CAMBRIDGE, England, 4th May 2007 - CeNeS Pharmaceuticals plc(LSE: CEN), the Cambridge based biopharmaceutical company, notesthe publication of an independent study in the respected scientificjournal 'Synapse'* on its Phase II NMDA antagonist, CNS 5161. CeNeSis developing CNS 5161 as a potential treatment for neuropathicpain. The independent study builds on the work that CeNeS hasalready...

Study Supports Cost-Effectiveness of Medtronic's Spasticity Treatment for Children with Cerebral Palsy

MINNEAPOLIS--(BUSINESS WIRE)--Apr 26, 2007 - A new study publishedin the current issue of the Journal of Child Neurology indicatesthat a treatment from Medtronic, Inc. (NYSE:MDT), for spasticity inchildren with cerebral palsy improves their quality of life and iscost-effective compared to other established cost-effectivetreatments. The findings of this Medtronic-sponsored study shouldexpand...
Other TagsPertussisPenta
(Date:10/10/2008)...ng point for behavior change, DES MOINES, Iowa, O...,Americans (51 percent) believe there are good thi...r changes are needed, according to the 2008,EBRI H...oday by the,Employee Benefit Research Institute an...derwritten by the Principal Financial Group(R)., ...
(Date:10/10/2008)...dentialing Center (ANCC) has designated Geisinger ...s came via a conference call to hospital administr...and applause., GMC joins an elite group of only 1...n the United States that have achieved Magnet stat...s recognition., "Achieving Magnet designation is ...
(Date:10/10/2008)... blame , , FRIDAY, Oct. 10 (HealthDay Ne...ve diabetes, being depressed was associated with a..., Publishing in the October issue of the Journal...he University of Washington tracked 10,704 Medicar...d diabetes and were enrolled in a disease manageme...
(Date:10/10/2008)...llence in the implementation of electronic health ...agement Systems Society (HIMSS) announces the reci...onal, Ambulatory and Community Health Organization...L (PRWEB) October 10, 2008 -- Honoring excellence ... (EHRs), the Healthcare Information and Managemen...
Breaking Medicine News(10 mins):Health News:Video: Just What the Doctor Ordered: Survey Shows Americans Adopting Healthier Lifestyles 2Health News:Video: Just What the Doctor Ordered: Survey Shows Americans Adopting Healthier Lifestyles 3Health News:Geisinger Medical Center earns prestigious Magnet designation 2Health News:Older Diabetics With Depression Face Higher Death Rate 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 3Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 4Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 5
(Date:10/9/2008)...he IOF World Congress on Osteoporosis 2008, at gre...ober 31, 2008. , To benefit from lower rates an...onehealth.org/wco/2008/homepage.html . Special re...m non-OECD countries and for IOF members. After Oc...r rates, will be possible. , Your chance to hea...
(Date:10/9/2008)...olecular Biology Laboratory (EMBL) have generated ...velopmental blueprint of a vertebrate. With a newl...rst time track all cells for the first 24 hours in...ed into a three-dimensional, digital representatio...nt online issue of Science , grants many new insi...
(Date:10/9/2008)...for life in higher animals, vitamin D, once linked...rosis, is now recognized as a major player in cont...verside,s Anthony Norman , an international exper...gust issue of the American Journal of Clinical N...l for contributions to good health in the adaptive...
(Date:10/9/2008)...search is a cornerstone of Frontiers in Optics 200...ciety (OSA), being held Oct. 19-23 at the Riversid...ill take place alongside Laser Science XXIV, the a...ivision of Laser Science. , Reporters interested... contact Colleen Morrison at 202.416.1437, cmorri...
Breaking Biology News(10 mins):Digital zebrafish embryo provides the first complete developmental blueprint of a vertebrate 2Vitamin D a key player in overall health of several body organs, says UC Riverside biochemist 2Vitamin D a key player in overall health of several body organs, says UC Riverside biochemist 3Where optics meets medicine 2Where optics meets medicine 3Where optics meets medicine 4Where optics meets medicine 5Where optics meets medicine 6Where optics meets medicine 7Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 1Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 2Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 3Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 4Abbott Scientists Present a New Approach for Treating Attention Deficit Hyperactivity Disorder 5183 5Silicons effect on sunflowers studied 3217 1Silicons effect on sunflowers studied 3217 2National scientific meeting on child mental health at Kentucky 3216 1National scientific meeting on child mental health at Kentucky 3216 2National scientific meeting on child mental health at Kentucky 3216 3Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 1Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 2Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 3Biopure Reaffirms Strategy Following Recent NIH FDA Workshop 18637 4
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia