Navigation Links


Standard in Medical News

To Save Payors Time, Effort and Resources, MEDai and Gold Standard Collaborate on New CMS Medication Therapy Management Initiative

ORLANDO, Fla., July 9 /PRNewswire/ -- MEDai, Inc. and Gold Standard, Inc., two Elsevier companies, today introduced MTM 360 , a complete medication therapy management (MTM) system that enables health plans, benefit sponsors and other payors to successfully meet CMS's expanded MTM Program requ...

TrinityCare Senior Living, Inc. Information to be Available Through Standard & Poor's Market Access Program

FRIENDSWOOD, Texas, July 1 /PRNewswire-FirstCall/ -- TrinityCare Senior Living, Inc. (OTC Bulletin Board: TCSR), which develops, manages and owns faith-based senior living facilities, today announced that its company information will be made available via Standard & Poor's Market Access Progr...

Lumenis' High Speed LightSheer(R) Duet(TM) Featured on ABC's Good Morning America Health as the New Gold Standard for Laser Hair Removal

Recommended for Fast & Comfortable Treatment with Low Risk & High Value SANTA CLARA, Calif., June 25 /PRNewswire/ -- Lumenis' High Speed LightSheer(R) Duet(TM) for permanent hair reduction was featured yesterday on ABC's Good Morning America Health with Dr. Doris Day, a leading U.S. D...

Hanger Orthopedic Group, Inc. Receives Upgrade from Standard & Poor's Rating Services

BETHESDA, Md., June 22 /PRNewswire-FirstCall/ -- Hanger Orthopedic Group, Inc. (NYSE: HGR ) is pleased to announce that Standard & Poor's Rating Services raised its rating on Hanger Orthopedic Group, Inc. to "B+" from "B." S&P also raised the issue level rating on Hanger's senior secure...

BioFit Intensive Plus™ Chairs Meet Federal Standard for Continuous Intensive Use

BioFit Engineered Products, an Ohio-based manufacturer and long-standing leader in the development of ergonomic seating solutions, announced today that its Intensive Plus line of 500-lb. capacity, continuous use chairs recently were rated compliant with the U.S. General Services Administration (G...

SVS 2009: Ziehm Imaging Sets a New Standard in Mobile Imaging With the Ziehm Vision RFD

RIVERSIDE, California and NUREMBERG, Germany, June 10 /PRNewswire/ -- Ziehm Imaging is proud to announce that the United States Food and Drug Administration (FDA) has given 510k clearance for the latest innovative mobile C-arm from Ziehm Imaging, the Ziehm Vision(R) RFD, for marketing and sale...

More>>

Standard in Medical Technology

Study Results Show That Minimally Invasive Therapy is Successful for Over Two-Thirds of Stroke Patients Treated Outside the Standard Eight-Hour Window

Findings May Potentially Lead to New Approach to Stroke Treatment BOCA RATON, Fla., July 30 /PRNewswire-USNewswire/ -- When minimally invasive endovascular (through the vessel) therapy made its debut two decades ago, stroke care underwent a major shift as the "window of treatmen...

University of Michigan Study Shows SEQUENOM's MassARRAY Technology Identifies HPV Infections Missed by Standard Hybridization Test

SAN DIEGO and ANN ARBOR, Mich., July 13 /PRNewswire-FirstCall/ -- Results from a study published by the University of Michigan have shown that as many as 15% of women in the study group determined to be negative for the presence of human papillomavirus (HPV) in the cervix, via ...

Final Results of Boceprevir Phase II HCV SPRINT-1 Study Showed Significantly Higher SVR Rates Compared to Standard of Care in Treatment-Naive Genotype 1 Hepatitis C Patients

48-week investigational regimen yielded nearly double SVR rate compared to standard of care Update on next-generation HCV protease inhibitor SCH 900518 presented at EASL annual meeting COPENHAGEN, Denmark, April 23 /PRNewswire-FirstCall/ -- Schering-Plough Corporation (NYSE: SGP ) toda...

Freezing Kidney Cancer: Hot Treatment Should Be New Gold Standard for Destroying Small Tumors

More Than 75 Percent of Patients Diagnosed Have Small Renal Cell Tumors; Safe Interventional Radiology Treatment Shown Near 100 Percent Effective in Destroying Localized Tumors, Says Johns Hopkins Study SAN DIEGO, March 9 /PRNewswire-USNewswire/ -- Freezing kidney tumors -- using a safe mi...

Angiomax Will Retain Decision Resources' Proprietary Clinical Gold Standard Status Over Current and New Therapies, Including Recently-Approved Efient, for the Treatment of NSTEMI

Angiomax Will Remain the NSTEMI Market Share Leader Through 2017, According to a New Report from Decision Resources WALTHAM, Mass., Feb. 25 /PRNewswire/ -- Decision Resources, one of the world's leading research and advisory firms for pharmaceutical and healthcare issues, finds that a therapy...

Compared to Standard Therapies, Pixantrone Decreases Time to Achieve Complete Remission by 47% in Relapsed Aggressive Non-Hodgkin's Lymphoma

SEATTLE, Feb. 18 /PRNewswire-FirstCall/ -- Cell Therapeutics, Inc. (Nasdaq and MTA: CTIC) announced today that updated safety and efficacy data from the phase III trial of pixantrone provides further support for a robust clinical benefit for pixantrone when used as single agent therapy in the ...

More>>

Standard in Medical Products

White Standard Girdle

Description: White Standard Girdle...
Company:Morris Designs Inc.

Cargille Microscope Immersion Oils - Standard Oils

Description: Cargille Immersion Oils are the standard - the ones to compare with, the ones to compete against. Cargille Laboratories has consistently led in the development and standardization of immersion oil for over 42 years. Here is the record: When the FDA set general purpose reagent criteria under the ...
Company:Cargille Labs

Agarose - BioChemika, for molecular biology, mixture of wide range and standard types 3:1

Description: Application: Forms strong flexible gels for separation of small ( ID clarifier: mixture of wide range and standard types 3:1 Solubility: water 10 mg/mL, clear, faintly yellow, hot Special grade: for molecular biology MP: 90 °C (1% in water) Suitab tst: electrophoresis test in accordance...
Company:Sigma-Aldrich

VersaFlex™ Standard Disposable pH Catheter

Description: The Standard VersaFlex™ disposable pH catheter is used by Gastroenterologists, Gastrointestinal nurses, and clinics worldwide for evaluating acid reflux events. VersaFlex disposable catheters for 24-hour esophageal pH monitoring. Alpine's VersaFlex catheters are the smallest diameter e...
Company:Alpine Biomed Corp.

DLP Standard Aortic Root Cannulae with Vent Line

Description: The Aortic Root Cannulae With Vent Line are flanged, with radiopaque tips; two side holes in tip....
Company:Medtronic Inc.

DLP Standard Aortic Root Cannulae

Description: The Aortic Root Cannula are flanged, with a radiopaque tips; two side holes in tip....
Company:Medtronic Inc.

More>>

Standard in Medical Definition

Allopathic medicine

...nical medicine, scientific medicine, regular medicine, mainstream medicine, standard medicine, orthodox medicine, and authoritarian medicine. History o... to an allopathic rationale (eg, using a laxative to relieve constipation), standard medicine has never paid allegiance to an allopathic principle" and that the...

Cachexia

...ne disorders . Cachexia physically weakens patients to a state of immobility stemming from loss of appetite, asthenia , and anemia , and response to standard treatment is usually poor. Contents 1 Disease settings 2 Mechanism 3 See also 4 External links ...

Fat transfer

...ons rely on the fat injections to shape the breasts for an aesthetic, natural-looking result. Despite the reports of some small studies, no current, standard method exists among physicians for preparing donated fat before injection back into the patient. For this and other reasons, the American Society of...

Hematopathology

...ukemias , lymphomas , plasma cell neoplasms , and histiocytic and mast cell neoplasms. Hematopathologists from all over the world have agreed on a standard classification system, called the " WHO classification". [1] Leukemias are mainly bone marrow and blood based and can be subclassified as c...

Medicine

...(ways of doing things) through the use of the scientific method and modern global information science by collating all the evidence and developing standard protocols which are then disseminated to healthcare providers. One problem with this 'best practice' approach is that it could be seen to stifle novel...

Positive predictive value

... Condition (as determined by " Gold standard ") True False Tes...agents such as a virus. In this situation the gold standard used in the evaluation study represents only the p...value. To evaluate diagnostic tests where the gold standard looks only at potential causes of disease, one may...
Standard in Medical Dictionary

Vein

... Call the Destin Vein Center at 850-654-5222 or toll free 866-701-7088 to ... The Vein Centre has built a reputation for providing the highest standard of ... Vein Procedures ... Vein Pain. Road of Life. View our Channel 4 Better Health ... Despite that, vein disease is often overlooked or...

Vector

...ras's ... Illustrates how to use the vector ::front and vector ::back standard Template Library (STL) ... sample declares an empty vector of integers wi...g ... Note:Source's vector class is geometric and very different from the standard ... Offers shared, reseller and dedicated plans. Also, provides domain ...

Urine culture

...h; Savannah Georgia GA, South Carolina SC St. Joseph_ s/Candler, Savannah Georgia GA, South Carolina SC Although the urine culture is the gold standard for diagnosing this condition, a ... If a culture of a bagged urine specimen does not have ... Urine culture . ... ... Library > Healt...

Umbilical cord

...to a public cord blood bank and give birth to hope for a patient in need. ... born, the umbilical cord was thrown away. ... Using 3D and standard ultrasound images, along with unique drawings and medical explanations, two professors ... the needle avoids the baby and umbilical cord . ... ...

Tryptophan

... Tryptophan is one of the 20 standard amino acids, as well as an essential amino acid in the human diet. It is encoded in the standard genetic code as the codon UGG. Only the L-stereo...rosine, and phenylalanine are the biggest of the standard ... Certified Vegetarian L-Tryptophan: 120 - 5...

Triglyceride level

...ls are associated with cardiovascular events such as a heart attack, with one study ... Triglycerides are fats that are measured along with standard cholesterol tests. ... Triglyceride levels are very sensitive to diet, exercise, and health habits. ... Why not use food to lower triglyc...
Standard in Biological News

UBC researchers help push for standard DNA barcodes for plants

Two University of British Columbia researchers are part of an international team recommending standards for the DNA barcoding of land plants, a step they hope will lead to a universal system for identifying over 400,000 species, and ultimately boost conservation efforts. Barcodes based on porti...

Free online toolkit provides standard measures for genome and population studies

The National Human Genome Research Institute (NHGRI), part of the National Institutes of Health, today announced the release of the first version of a free online toolkit aimed at standardizing measurements of research subjects' physical characteristics and environmental exposures. The tools will ...

Freezing kidney cancer: Hot treatment should be new gold standard for destroying small tumors

SAN DIEGO, Calif. (March 9, 2009)Freezing kidney tumorsusing a safe minimally invasive interventional radiology treatment that kills the cancer 100 percent effectively without surgeryshould be the gold standard or first treatment option for all individuals with tumors that are 4 centimeters in siz...

New standard for popular stevia-based sweetener to assure product's quality

Rockville, Md., January 5, 2009 Responding to the growing popularity of a plant-based sweetener, the U.S. Pharmacopeial (USP) Convention today announced it is developing a new standard to be included in the Food Chemicals Codex (FCC) that will help food and beverage manufacturers assure the produ...

Field Museum provides gold standard for mammal survey

CHICAGO, Oct. 6, 2008 Putting together the Who's Who of bats, bears, beaked whales and all of Earth's other known mammals was a gigantic task ably assisted by a Field Museum scientific team with access to one of the planet's most extensive and diverse mammal collections. A team headed by the I...

Positron emission tomography superior to standard evaluation tools in measuring treatment response

Positron Emission Tomography (PET) was much more sensitive and more accurate than conventional imaging methods in detecting response to treatment in sarcoma patients, according to a UCLA study that is among the first to directly compare PET to CT scanning. The study has important implications ...
Standard in Biological Technology

Lixte Biotechnology Holdings' Lead Compound, LB-1.2, Enhances the Effectiveness of Standard Cancer Chemotherapy in Animal Models

EAST SETAUKET, N.Y., July 2 /PRNewswire-FirstCall/ -- Lixte Biotechnology Holdings (OTC Bulletin Board: LIXT) announced today that investigators of the National Institute of Neurological Disorders and Stroke (NINDS) and the National Cancer Institute (NCI), National Institutes of Health and Lixte r...

Rutgers University Cell and DNA Repository Adopts BioLife Solutions CryoStor(TM) as Standard Biopreservation Media

BOTHELL, Wash., April 13 /PRNewswire-FirstCall/ -- BioLife Solutions, Inc. (OTC Bulletin Board: BLFS), a leading developer and marketer of proprietary cGMP hypothermic storage and cryopreservation media products for cells, tissues, and organs, today announced that the Rutgers University Cell...

Novartis/Schering-Plough's Drug Will Replace AstraZeneca's Symbicort as Decision Resources' Clinical Gold Standard by 2012 for the Treatment of Asthma

A Therapy's Effect on Reduction of Exacerbations is the Attribute That Most Influences Physicians' Prescribing Decisions, According to a New Report from Decision Resources WALTHAM, Mass., Feb. 24 /PRNewswire/ -- Decision Resources, one of the world's leading research and advisory firms for ph...

New Analysis Finds Bioidentical Hormones Safer Than Standard Hormone Replacement Therapy

Comprehensive review demonstrates bioidentical hormones are superior to synthetic HRT with greater cardiovascular benefits and reduced risk of breast cancer TORRANCE, Calif., Feb. 23 /PRNewswire/ -- The most comprehensive analysis to date, published in the Postgraduate Medical Journal, a lead...

Agendia's Breast Cancer Test MammaPrint(R) Standard of Care at Netherlands Cancer Institute - AVL

HUNTINGTON BEACH, California and AMSTERDAM, February 4 /PRNewswire/ -- Agendia, a world leader in molecular cancer diagnostics, today announced that its signature breast cancer test MammaPrint(R) will be offered as standard of care for all eligible early stage breast cancer patients at the Net...

Interleukin Genetics Receives Notification of Failure to Meet Continued Listing Standard Section 1003(a)(iii)

WALTHAM, Mass., Dec. 26 /PRNewswire-FirstCall/ -- Interleukin Genetics, Inc. (NYSE Alternext US: ILI) announced today, that on December 23, 2008 the Company received notice from the NYSE Alternext US LLC (the "the Exchange") indicating that the Company is not in compliance with certain conditions ...

More>>

Standard in Biological Products

Beadlyte® Human IgE Standard from Upstate

Description: Applications: Beadlyte® assay Stability: 2 years at 4°C (lyophilized) or 6 months at -20°C (rehydrated) ...
Company:Upstate

Silencer Pre-designed siRNA, standard purity from Ambion

Description: ...
Company:Ambion

Silencer Pre-designed siRNA, standard purity, annealed from Ambion

Description: ...
Company:Ambion

Custom siRNA, standard purity from Ambion

Description: ...
Company:Ambion

Custom siRNA, standard purity from Ambion

Description: ...
Company:Ambion

Custom siRNA, standard purity, annealed from Ambion

Description: ...
Company:Ambion

More>>

Standard in Biological Definition

Amino acid

... 2.1 Isomerism 3 Reactions 4 List of standard amino acids 4.1 Structures 4.2 Chemical ...proteins . Twenty amino acids are encoded by the standard genetic code and are called proteinogenic or standard amino acids . Rarer, more complicated ones are pro...

Avian influenza

... had cared for avian flu patients have tested positive for the disease. Prevention and treatment Avian influenza in humans can be detected with standard influenza tests. However, these tests have not always proved reliable. In March 2005, the World Health Organization announced that seven Vietnamese wh...

Biodiversity

...iodiversity 10 See also 11 External links 11.1 Directories Biodiversity definitions Biological diversity has no single standard definition. One definition holds that biological diversity is a measure of the relative diversity among organisms present in different ecosystems ....

BLAST

...repeated. By including related proteins in the search, PSI-BLAST is much more sensitive in picking up distant evolutionary relationships than the standard protein-protein BLAST. Nucleotide-protein 6-frame translation (blastx) : This program compares the six-frame conceptual translation products of ...

Full blood count

...lls within the blood. The machine prints out, and/or sends to a computer, the results. Blood counting machines work by sampling blood, and sucking a standard amount through narrow tubing. Within this tubing, there are sensors that count the number of cells going through it, and can identify the type of cell...

Cancer

...a new treatment being tested or the best available standard treatment for their cancer. Of course, there is no guarantee that a new treatment being tested or a standard treatment will produce good results. New treatment... treatment proves effective or more effective than standard treatment, study patients who receive it may be am...
Standard in Biological Dictionary

Vestigial organ

...e demonstrated remarkably how ... The term ? vestigial organ ? ... The standard definition of vestigial ' is an organ that once was useful in an ... The...stries International, world renowned creationist ministry, formerly ... The standard definition of vestigial ' is an organ that once was useful in an ... ...

Variation

.... Variation - The Root Of All Process Evil ... How to evaluate and eliminate variation in your business processes. ... Variation . Page 3 > standard Deviation: Arguably The Most Important Variation Measure ... A summary of Inverse Variation in Variation . Learn exactly what happened in this...

Uric acid

... acid is the end product of purine degradation. ... High uric acid is a subtype of autism that responds to dietary restriction of ... The standard test for elevated uric acid in serum may not be abnormal in this ... Video of Uric Acid / Tophi Deposits caused by Gout Attacks in Dissec...

Tube feet

...m for the Andrea Jovine Women's 1 Pair Dots Foot Tube . Find thousands of brand name shoes and handbags at prices you love. ... from the Evening standard here, and also a classic example of tube foot . ... Tube Foot . Show machine tags (0) Hide machine tags (0) Additional Information ... ...

Transgenic mouse

...non- transgenic mice to demonstrate germ ... Transgenic mice have become powerful reagents for modeling genetic disorders, ... To generate a standard transgenic mouse , a bacterial or viral vector containing ... ... years since, these " transgenic " and "knockout" mice have become commonpl...

Taq polymerase

...technology software, equipment and supplies distributor. ... Taq DNA Polymerase . TthPlus DNA Polymerase . Anti- Taq Monoclonal ... Generally, standard Taq DNA Polymerase has difficulty amplifying targets >5 kb. ... general guidelines for primers to be used with Takara's Ex Taq ™ Polymerase ?...
Other TagsPathogenPathogenEffectiveEffectiveEffectiveEffectiveExpressionExpressionExpressionExpressionAsthmaAsthmaAsthmaChildrenChildrenChildrenChildrenChildrenTowardsTowardsVascularVascularVascularVascularVascularVascular
(Date:11/20/2009)...SHINGTON, Nov. 20 The U...the Senate to make essential changes its health re... abortion funding and conscience protection on abo...s and include strong provisions for adequate affor...th care bill an "enormous disappointment" that cre...
(Date:11/20/2009)..., Nov. 20 The American ... and Drug Administration (FDA) to establish approp...s. ,, Citing concern about the safety of white...the benefit of professional consultation or examin...application of chemically based tooth whitening or...
(Date:11/20/2009)...S, Nov. 20 The followin...tor of the Nevada Health Care Association: ,, "... and thanks Senate Majority Leader Harry Reid for ...toward our goal of protecting every Nevada seniors... preserving the strength and viability of our stat...
(Date:11/20/2009)...ure readings in children with chronic kidney disea...doctor,s office visits increasing a child,s risk ...from Johns Hopkins Children,s Center and other ins... in the Journal of American Society of Nephrology....ments obtained during regular doctor visits to rea...
(Date:11/20/2009)...to one-third buying 90-day supply, study finds , ...ing a three-month supply of prescription drugs is ...pply, according to a new study. , U.S. research...rugs between 2000 and 2005, and found that patient...-month supply saved an average 29 percent in out-o...
Breaking Medicine News(10 mins):Health News:U.S. Bishops Voice Disappointment in Abortion-Funding Provisions in Senate Health Bill, Urge Better Care for Immigrants and Affordability 2Health News:American Dental Association Petitions FDA to Classify, Regulate Tooth-Whitening Products 2Health News:High blood pressure easy to miss in children with kidney disease 2Health News:Three-Month Supply Lowers Drug Costs 2
(Date:11/20/2009)...searchers report that a class of heart medications...ul, effect on the heart, depending on their molecu...journal Circulation Research , found that beta-bl...ors on the heart muscle offer the most benefit to ... beta-receptors can actually undermine the structu...
(Date:11/19/2009)...revealing the genetic instructions inside corn, on...as one of the most complex sequences of DNA ever a...micist David Schwartz, who was one of more than 10... , "The maize genome is a true maze full of con...uld-be sequencers for years," says Schwartz. , P...
(Date:11/19/2009)...rsity in maize, also known as corn, researchers ac...that should pave the way to significant improvemen..., animal feed and fiber around the world. , The ...lotype map, charts genetic diversity and recombina.... The research team, led by U.S. Department of Agr...
Breaking Biology News(10 mins):Carvedilol shown to have unique characteristics among beta blockers 2Sweet corn story begins in UW-Madison lab 2Sweet corn story begins in UW-Madison lab 3Clearly Contacts Introduces New Spring Eyewear Lineup 47736 1Clearly Contacts Introduces New Spring Eyewear Lineup 47736 2Clearly Contacts Introduces New Spring Eyewear Lineup 47736 3Wake Up 26 Smell the Coffee 47731 1Wake Up 26 Smell the Coffee 47731 2Wake Up 26 Smell the Coffee 47731 3Parents In Kansas Can Now Test Their Children For Lead Exposure Using Saliva 47727 1Parents In Kansas Can Now Test Their Children For Lead Exposure Using Saliva 47727 2Parents In Kansas Can Now Test Their Children For Lead Exposure Using Saliva 47727 3Parents In Kansas Can Now Test Their Children For Lead Exposure Using Saliva 47727 4
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesisclade