Navigation Links


Sizes at Biology News

Sizes at Biology Products

SizeSep 400 Spun Columns from GE Healthcare, formerly Amersham Biosciences

Description:SizeSep 400 Spun Columns, 10. *Provided wi...
Company:GE Healthcare, formerly Amersham Biosciences
Sizes at Biology Technology

PCR-Grade Nucleotides Larger Pack Sizes Now Available

Roche Applied Science now offers new larger pack sizesof PCR-Grade Nucleotides. These larger pack sizescombine the best available quality with attractive pricing. Single dN...
Sizes at Medicine News

NHS Downsizes Medication Goes Online

NHS Direct is a part of National Health Service (NHS) that offers support to patients over the phone. It is a telephone advice service which has decided// to cut hundreds of jobs as part of a restructuring programme. The organisation said that discussions were still going on about the issue. But unions fear that as many as 1,000 jobs would be lost at NHS Direct. This was set up eight ye...

Cancer-Causing Virus Synthesizes Protein To Help Sustain Itself In Host Cells

A protein that is synthesized by a cancer-causing virus enables it to bypass immune systems and infect the immune cells. This mechanism uses an unusual gene and also ensures that the virus persists in the host. // The study examines the function of a protein called HBZ, which is made by the human T cell leukemia virus type 1 (HTLV-1), a retrovirus and a distant cousin to HIV, the cau...

How Portion Sizes Have Increased Waistlines

A new study has revealed that most people are eating and drinking more today at each meal without even being aware of it. In fact even the extra orange juice we consume could add five pounds a year.// Researchers at Rutgers came up with the idea of replicating a portion-size study from 20 years ago where in people were asked to serve themselves a "typical portion" of meal items from a...

Waistlines Growing with Portion Sizes

A new study has revealed that most people are eating and drinking more today at each meal without even being aware of it. In fact even the extra orange juice we consume could add five pounds a year.// Researchers at Rutgers came up with the idea of replicating a portion-size study from 20 years ago where in people were asked to serve themselves a "typical portion" of meal items from a...

Portion Sizes in Restaurants Larger than Before

Portion sizes dished out by most restaurant chefs are two to four times bigger than the government's recommended serving sizes. Knowing well that these large amounts are// contributing to increasing weight of their diners, the chefs believe customers expect large platefuls of food when eating out. These were the findings that were revealed by a survey of 300 chefs presented at the ann...

More>>

Sizes at Medicine Products
Sizes at Medicine Technology
Other TagsPertussisPenta
(Date:10/10/2008)...ng point for behavior change, DES MOINES, Iowa, O...,Americans (51 percent) believe there are good thi...r changes are needed, according to the 2008,EBRI H...oday by the,Employee Benefit Research Institute an...derwritten by the Principal Financial Group(R)., ...
(Date:10/10/2008)...dentialing Center (ANCC) has designated Geisinger ...s came via a conference call to hospital administr...and applause., GMC joins an elite group of only 1...n the United States that have achieved Magnet stat...s recognition., "Achieving Magnet designation is ...
(Date:10/10/2008)... blame , , FRIDAY, Oct. 10 (HealthDay Ne...ve diabetes, being depressed was associated with a..., Publishing in the October issue of the Journal...he University of Washington tracked 10,704 Medicar...d diabetes and were enrolled in a disease manageme...
(Date:10/10/2008)...llence in the implementation of electronic health ...agement Systems Society (HIMSS) announces the reci...onal, Ambulatory and Community Health Organization...L (PRWEB) October 10, 2008 -- Honoring excellence ... (EHRs), the Healthcare Information and Managemen...
Breaking Medicine News(10 mins):Health News:Video: Just What the Doctor Ordered: Survey Shows Americans Adopting Healthier Lifestyles 2Health News:Video: Just What the Doctor Ordered: Survey Shows Americans Adopting Healthier Lifestyles 3Health News:Geisinger Medical Center earns prestigious Magnet designation 2Health News:Older Diabetics With Depression Face Higher Death Rate 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 3Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 4Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 5
(Date:10/10/2008)...in German . , DNA, the molecule that acts as ... life, is highly resistant against alteration by u...for its photostability presents some puzzling prob...four chemical bases that make up the DNA molecule....showing that DNA strands differ in their light sen...
(Date:10/9/2008)...onventional wisdom, tropical plant and animal spec...may be threatened by global warming, according to ...Robert K. Colwell and colleagues in this week,s (O...s climate has warmed in recent decades, the geogra... plant species in the US and Europe have moved nor...
(Date:10/9/2008)..., 2008 The Indonesian government and World Wildli... protect the remaining forests and critical ecosys...ome of the world,s most diverse and endangered f...t-ever island-wide commitment to protect Sumatra,s...n endorsed by governors of all provinces across Su...
(Date:10/9/2008)... 2008 The United States lacks the policies needed ...not cause environmental harm, says a distinguished...lished in the October 3rd issue of the journal Sc...nd incentives that will help ensure that future pr...ly and environmentally. , Because the cellulosic...
Breaking Biology News(10 mins):Can genetic information be controlled by light? 2Tropical rainforest and mountain species may be threatened by global warming 2Saving Sumatra: Indonesia reaches historic agreement 2Experts agree: to protect the environment, biofuel standards are needed 2St Jude Researchers Find Key Step in Programmed Cell Death 13184 1St Jude Researchers Find Key Step in Programmed Cell Death 13184 2St Jude Researchers Find Key Step in Programmed Cell Death 13184 3Increased allergen levels in homes linked to asthma 2368 1Increased allergen levels in homes linked to asthma 2368 2Chemo Break Benefits Some Men With Prostate Cancer 13179 1Chemo Break Benefits Some Men With Prostate Cancer 13179 2Cancer theory stands the test of time rediscovering Boveri a century later 13176 1
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia