Navigation Links


Resistance in Medical News

Genes key to staph disease severity, drug resistance found hitchhiking together

Scientists studying Staphylococcus bacteria, including methicillin-resistant S. aureus (MRSA), have discovered a potent staph toxin responsible for disease severity. They also found the gene for the toxin traveling with a genetic component of Staphylococcus that controls resistance to antibi...

Equine Obesity is Associated with Significant Health Issues, Including Insulin Resistance and Laminitis

Vet-A-Mix announces the release of an optimal nutritional supplement to support overall health and laminitis prevention for at-risk horses. Shenandoah, IA (PRWEB) June 24, 2009 -- Equine obesity is on the rise in the United States. A large percentage of these horses are...

Discovery of variations in resistance to sulfadoxine across Africa

Researchers have discovered that malaria parasites in east and west Africa carry different resistance mutations, which suggests that the effectiveness of sulfadoxine as an antimalarial drug may vary across Africa. The findings have implications for the manner in which malaria control campaigns...

Rep. Slaughter Reintroduces Bill to Help Fight Antibiotic Resistance Crisis by Combating Misuse of Antibiotics in Animal Agriculture

WASHINGTON, March 17 /PRNewswire-USNewswire/ -- Keep Antibiotics Working (KAW) -- a national coalition of health, consumer, agricultural, environmental, humane, and other advocacy groups with more than ten million supporters -- today welcomed the reintroduction of a bill that would help combat t...

'Fasting Signal' Offers Clues to Insulin Resistance in the Obese

Drugs blocking this communication may offer therapeutic benefits, mouse study finds TUESDAY, March 3 (HealthDay News) -- A signal known to play a role during fasting also becomes active in the fat tissue of obese mice in the early stages of progression toward type 2 diabetes, say res...

Adding Eccentric Resistance Training Improves Muscle Strength Following ACL Surgery

Full recovery from an anterior cruciate ligament (ACL) reconstruction can be difficult, but a review of several studies from the University of Utah published in the inaugural edition of Sports Health: A Multidisciplinary Approach highlights how the use of eccentric resistance training may improve...

More>>

Resistance in Medical Technology

Cepheid Announces European Release of First On-Demand Molecular Test for Simultaneous Detection of Mycobacterium tuberculosis (TB) and Resistance to Rifampicin

Unique GeneXpert(R) System Capabilities Enable Powerful New TB Diagnostic Tool SUNNYVALE, Calif., April 27 /PRNewswire-FirstCall/ -- Cepheid (Nasdaq: CPHD ) today announced the release of Xpert(R) MTB/RIF as a CE IVD Mark product under the European Directive on In Vitro Diagnostic Medical...

RAD001 Shows Potential to Reverse Resistance to Herceptin(R)* in Metastatic Breast Cancer Patients, Leading to Phase III Trial

EAST HANOVER, N.J., Dec. 12 /PRNewswire/ -- New data from two early clinical studies show that RAD001(R) (everolimus) may overcome resistance to Herceptin(R) (trastuzumab)* in women with HER2-positive metastatic breast cancer. These results support the initiation of a Phase III clinical trial prog...

Early Data Presented at ASCO Show Potential of RAD001 to Enhance Efficacy of, and Overcome Resistance to, Breast Cancer Treatments

- Randomized Phase II data show RAD001 significantly increased efficacy of letrozole tablets in women with newly diagnosed hormone-positive breast cancer - Phase I studies suggest RAD001 may help overcome a major pathway of resistance to ...

St. Jude Gene Study Reveals Basis of Anti-Cancer Drug Resistance in Childhood Leukemia

The findings provide new insights into genomic basis of methotrexate resistance and differences in methotrexate response MEMPHIS, Tenn., April 15 /PRNewswire-USNewswire/ -- The first analysis of the genetic determinants of resistance to the anti-cancer drug methotrexate in childhood acute ...

ANX-201 Demonstrates a Unique Resistance Profile in Preclinical Tests

ADVENTRX Presents Results at Keystone Symposia HIV Pathogenesis Conference SAN DIEGO, March 31 /PRNewswire-FirstCall/ -- ADVENTRX Pharmaceuticals, Inc. (Amex: ANX ) announced that it presented preclinical results for ANX-201, the Company's broad-spectrum antiviral product candidate at the Keys...

BARACLUDE(R) (entecavir) Data Continue to Demonstrate Low Incidence of Resistance Through Five Years of Treatment in Nucleoside-naive Chronic Hepatitis B Patients

- Data Indicate Pre-existing Lamivudine Resistance Predisposes Patients to Higher Rates of BARACLUDE Resistance - PRINCETON, N.J., March 24 /PRNewswire-FirstCall/ -- New BARACLUDE(R) (entecavir) data presented today demonstrated a continued low incidence of resistance in nucleos...

More>>

Resistance in Medical Products

APC Resistance Profile with Reflex to Factor V Leiden

Description: ARUP Laboratories is a national reference laboratory and a worldwide leader in innovative laboratory research and development. ARUP offers an extensive test menu of highly complex and unique medical tests in clinical and anatomic pathology. Owned by the University of Utah, ARUP Laboratories' client...
Company:ARUP Laboratories

APC Resistance Profile

Description: ARUP Laboratories is a national reference laboratory and a worldwide leader in innovative laboratory research and development. ARUP offers an extensive test menu of highly complex and unique medical tests in clinical and anatomic pathology. Owned by the University of Utah, ARUP Laboratories' client...
Company:ARUP Laboratories

APC Resistance Mutation Detection

Description: ARUP Laboratories is a national reference laboratory and a worldwide leader in innovative laboratory research and development. ARUP offers an extensive test menu of highly complex and unique medical tests in clinical and anatomic pathology. Owned by the University of Utah, ARUP Laboratories' client...
Company:ARUP Laboratories

Coatest APC Resistance V Kit

Description: An APTT-based kit for the screening of factor-V-related APC resistance. The high sensitivity and specificity of the test for the factor V:Q506 mutation is obtained by prediluting the sample plasma with an excess of V-DEF Plasma bioreagent. The test design makes it possible to discriminate between h...
Company:DiaPharma Group, Inc.

Coatest APC Resistance Kit

Description: An APTT-based assay for the detection of the APC resistance phenotype, i.e. the poor anticoagulant response to activated protein C (APC). The test result (APC ratio) gives an estimation of the anticoagulant function in vivo and provides information on the thrombotic risk associated with inherited a...
Company:DiaPharma Group, Inc.

Protein C Resistance

Description: ARUP Laboratories is a national reference laboratory and a worldwide leader in innovative laboratory research and development. ARUP offers an extensive test menu of highly complex and unique medical tests in clinical and anatomic pathology. Owned by the University of Utah, ARUP Laboratories' client...
Company:ARUP Laboratories

More>>

Resistance in Medical Definition

Pathology

...rease in the size of cells in a tissue in response to stress, an example being hypertrophy of muscle cells in the heart in response to increased resistance to blood flow as a result of narrowing of the heart's outflow valve . Metaplasia occurs when repeated damage to the cellular lining of an organ tri...
Resistance in Medical Dictionary

Resistance

The electrical resistance of an object is a measure of its opposition to the passage of a steady electric current. An object of uniform cross section will have a resistance proportional to its length and inversely... Electrical resistance , a measure of the degree to which an ... Resis...

Drug Resistance

Drug resistance is the reduction in effectiveness of a drug in curing a disease or improving a patient's symptoms. When the drug is not intended to kill or inhibit a pathogen, then the term is equivalent to dosage failure or drug tolerance. More commonly, the term is... Drug ...

Antibiotic Resistance

Antibiotic resistance is the ability of a microorganism to withstand the effects of antibiotics. It is a specific type of drug resistance . Antibiotic resistance evolves via natural selection acting upon random mutation, but... Information on antibiotic /antimicrobial resistance ...

Vaccinations

...nation . ... Why do puppies and kittens require a series of vaccinations ? ... Immunizations ( vaccinations ) are given to initiate or augment resistance to an ... Vaccinations against the following disorders are also recommended routinely for ... Immunizations . Alternative Names Return to top....

Type II diabetes

... type 2 or type 2 diabetes , or adult-onset diabetes ) is a disorder that is characterized by high blood glucose in the context of insulin resistance and relative insulin deficiency. While it is often initially... ... all persons with type 1 diabetes must take insulin injections. ....

Type 2 diabetes

...s type 2 or type 2 diabetes , or adult-onset diabetes ) is a disorder that is characterized by high blood glucose in the context of insulin resistance and relative insulin deficiency. While it is often initially... Likewise, the term " type 2 diabetes " has replaced severa...
Resistance in Biological News

Rapid approach to identify influenza A virus mutations and drug resistance developed

Genome Institute of Singapore scientists, led by Christopher Wong, Ph.D., have developed a novel approach to uncover the complete sequence of any influenza A virus, including H1NI, with just a quick nasal swab or nasal pharyngeal wash from patients. The new method, which enables scientists to ...

Weed resistance to glyphosate in genetically modified soybean cultivation in Argentina

The article written by Rosa Binimelis, Walter Pengue and Iliana Monterroso, is the product of collaborative work among the Autonomous University of Barcelona, University of Buenos Aires and the Latin American Faculty of Social Sciences in Guatemala. The article describes the geographical advance ...

Building strong bones: Running may provide more benefits than resistance training, MU study finds

COLUMBIA, Mo. Osteoporosis affects more than 200 million people worldwide and is a serious public health concern, according to the National Osteoporosis Foundation. Resistance training often is recommended to increase and prevent loss of bone mineral density (BMD), although previous studies that...

Decreasing insulin resistance prevents obesity-related cardiovascular damage

AUGUSTA, Ga. - Knocking out one gene that contributes to insulin resistance appears to prevent much of the cardiovascular damage typically associated with obesity, researchers say. Cardiovascular disease is the biggest health threat of obesity and Medical College of Georgia researchers trying t...

Stroma genomic signature predicts resistance to anthracyclin-based chemotherapy in breast cancer

Researchers at the Swiss Institute of Bioinformatics and the Swiss National Center of Competence in Research in Molecular Oncology in Lausanne have developed a new test to predict how breast cancer patients respond to chemotherapy, which could help change how treatment is delivered in the future. ...

Lead-flapping objects experience less wind resistance than their trailing counterparts

It is commonly known that racing cars and bicyclists can reduce air resistance by following closely behind a leader, but researchers from New York University and Cornell University have found the opposite is true with flapping objects, such as flags. Their study, published in the most recent issue...

More>>

Resistance in Biological Technology

University of Lodz Invests in the Unique Cellaxess(R)HT System for Research on Multidrug Resistance Genes in Cancer

GOTHENBURG, Sweden, July 22 /PRNewswire/ -- Cellectricon, a leading provider of cell-based screening solutions for research and drug discovery, today announced its collaboration with University of Lodz, Poland. Under the agreement University of Lodz invests in Cellaxess(R)HT, the world's first...

Virco Lab, Inc. Enters Into Collaboration with SmartGene, Inc. Enhancing HIV Resistance Test Services for Laboratories and Physicians

BRIDGEWATER, N.J., April 20 /PRNewswire/ -- Virco Lab, Inc. a leader in HIV resistance testing services, is pleased to announce a US collaboration with SmartGene, Inc., a provider of novel services for the management and analysis of genetic data to provide laboratories and physicians with greater ...

SmartGene, Inc. Enters Collaboration with Virco Lab, Inc. to Enhance HIV Genotyping and Resistance Interpretation Services in US

RALEIGH, N.C., April 20 /PRNewswire/ -- SmartGene, Inc., a provider of novel services for the management and analysis of genetic data, today announced a marketing and distribution collaboration with Virco Lab, Inc., to help US laboratories manage, analyze, and derive maximum benefit from th...

MIT, BU team combats antibiotic resistance with engineered viruses

CAMBRIDGE, Mass.--A new approach to fighting bacterial infections, developed at MIT and Boston University, could help prevent bacteria from developing antibiotic resistance and help kill those that have already become resistant. Researchers from both schools have engineered a virus that knocks ...

Mosquito genes linked to insecticide resistance may be new target in fight against malaria

Malaria remains one of the most serious diseases worldwide, claiming the lives of more than one million people per year in tropical and sub-tropical regions, the majority of whom are children under five years of age. Efforts to eliminate this mosquito-borne illness rely heavily on prevention meas...

Exiqon Announces Positive Clinical Data From EORTC Clinical Trial Showing Oncotech EDR Assay Predicts Resistance to Platinum-Based Therapy in Ovarian Cancer

VEDBAEK, Denmark, October 27 /PRNewswire-FirstCall/ -- The European Organization for Research and Treatment of Cancer (EORTC) has undertaken a multi-institutional prospective randomized clinical trial on 719 late stage epithelial ovarian cancer patients (named 55971). Results were announced to...
Resistance in Biological Products

Multidrug Resistance Fluorometric (Calcein AM) Assay Kit, Vybrant® from Molecular Probes (Invitrogen)

Description: Vybrant® Multidrug Resistance Assay Kit...
Company:Molecular Probes (Invitrogen)

Origami(DE3) Glycerol Stock from Novagen

Description:...ns are selectable on kanamycin and tetracycline, respectively; therefore, this strain is recommended for use with pET plasmids carrying the ampicillin resistance marker bla....
Company:Novagen

Origami(DE3)pLysS Glycerol Stock from Novagen

Description:...ns are selectable on kanamycin and tetracycline, respectively; therefore, this strain is recommended for use with pET plasmids carrying the ampicillin resistance marker bla....
Company:Novagen

Zero Background/Kan Cloning Kit from Invitrogen

Description:... The Zero Background/Kan Cloning Kit includes the pZErO-2 vector with kanamycin resistance for selection in E. coli. The pZErO-2 vector utilizes positive selection to eliminate high background. The kit contains all of the reagents you need f...
Company:Invitrogen

Zero Background Cloning Kit from Invitrogen

Description:... The Zero Background Cloning Kit includes the pZErO-1 vector with Zeocin resistance for selection in E. coli. The pZErO-1 vector utilizes positive selection to eliminate high background. The small size of the Zeocin resistance gene reduces the overall vector size for increased ligation and transformat...
Company:Invitrogen

T2-04 Diaphragm Pump from Parker Hannifin Corporation

Description:... Range of custom configurations and optional motors available to optimize drop-in size, performance, and cost. Alternative materials for chemical resistance to corrosive atmospheres available. ...
Company:Parker Hannifin Corporation
Resistance in Biological Definition

Antibiotic resistance

Antibiotic resistance is the ability of a microorganism to withstand the effects of an antibiotic . Antibiotic resistance develops through mutation or plasmid exchange between bacteria of the same species . If a bacterium carries several resistance genes, it is called multiresistant ...

Antibiotic resistance

Antibiotic resistance is the ability of a microorganism to withstand the effects of an antibiotic . Antibiotic resistance develops through mutation or plasmid exchange between bacteria of the same species . If a bacterium carries several resistance genes, it is called multiresistant ...

Antibiotic

...effects 4 Antibiotic misuse 5 Antibiotic resistance 6 Beyond antibiotics 7 External links ...failure, these practices can result in antibiotic resistance . In the United States, a vast quantity of antib... no evidence as yet of such transfer of antibiotic resistance actually occurring. Antibiotic...

Apoptosis

...60 cells with a Smac peptide (SmacN7) that targets IAPs. Yang and her team successfully developed a SmacN7 peptide that selectively reversed apoptosis resistance - and hence tumor growth - in H460 cells in mice. (See also the role of Gefitinib and peptidomimetics in restoring apoptotic pathways.) Ro...

Culture

...a whole, they often reveal processes of domination and resistance. Cultural change Cultures are both predisposed to change and resistant to it. resistance can come from habit, religion and the integration and interdependence of culture traits. For example, men and women have complementary roles in many c...

Diabetes mellitus

... the effects of insulin (insulin insensitivity or resistance ), or if the insulin itself is defective, glucose ...s Type 2 diabetes is characterized by " insulin resistance " as body cells do not respond appropriately when ...bese - chronic obesity leads to increased insulin resistance that can develop into diabetes, most likely becaus...
Resistance in Biological Dictionary

Tet resistance

From Wikipedia, the free encyclopedia (Redirected from Tet resistance ) ... Resistance to tetracyclines can arise through drug efflux, ribosomal protection ... ... moderate resistance to macrolides (10), and tet genes coding for ribosomal ... resistance genes have been found in ...

Antibiotic resistance

Antibiotic resistance is the ability of a microorganism to withstand the effects of antibiotics. It is a specific type of drug resistance . Antibiotic resistance evolves via natural selection acting upon random mutation, but... Information on antibiotic /antimicrobial resistance . Provi...

Amp resistance

Amp resistance is an abbreviation for resistance to the antibiotic ampicillin. It is used as a selectable marker in bacterial transformation. See antibiotic resistance Epigenetic inheritance of this amp resistance gene expression pattern would ... Amp resistance due to ...

Virulence

...rs that make the bacterium responsible for the plague ... Microbial Drug resistance and Virulence (MDRV) will evaluate microbial drug resistance and the mechanisms of virulence (infection potential) in microbial cultur...

Vestigial organ

...dresses the scientific evidences in favor of ... Though many vestigial organs have no function, complete non-functionality is not ... Bacterial resistance to Antibiotics The Myth of Vestigial Organs . Yet Another Blow To " Vestigial Organs ": The Leg of the Horse. The Recapitulation Misconception .....

Tricuspid valve

...ich results in the narrowing of the orifice of the tricuspid valve of the heart. It's relatively a rare condition. The stenosis causes increased resistance to blood flow through the valve . The tricuspid valve regulates blood flow from the heart's upper-right chamber to the lower-right chamber. .....
Other TagsHandleHandleMultivitamins
(Date:11/24/2009)..., NEWYORK,Nov.24/PRNewswire-USNewswire/--Ther...oblems.Itisharmreduction,offeringpragmaticandreali...roblemshavefailed.Spearheadingthismovementisagroup...rationSupport.HAMSisafree-of-charge,lay-ledsupport..., TheNationalInstituteonAlcoholAbuseandAlcoholism...
(Date:11/24/2009)..., NEWYORK,Nov.24/PRNewswire/--TheGuardianLife...tmutuallifeinsurersandaleadingproviderofemployeebe...thatthecompanywillcontinuetofollowitscurrentinsura...eguidelinesareconsistentwiththeAmericanCancerSocie...sformammographyscreenings. ,, Recently,TheU.S.P...
(Date:11/24/2009)..., ChangesMustBeMadetoUSPSTFRepresentationand...ewswire-USNewswire/-- SeveralsectionsofSenatehealt...hatinsuranceentitiessuchasprivateinsurers,Medicare...vingaspecificgradefromtheU.S.PreventativeServicesT...icesforwomen40-49,wouldonlyrequirecoverageofbienni...
(Date:11/24/2009)... BEER-SHEVA, ISRAEL November 24, 2009 Researchers...ing a new device that detects cancerous skin tumor...naked eye. , During initial testing, the OSPI in...vealed new textures of lesions that have never bee... were diagnosed with various skin lesions and were...
(Date:11/24/2009)... INDIANAPOLIS Involving family members of pediatr...s benefits both the family and the medical team, a...icine study. , Riley Hospital for Children, whe...mall number of hospitals nationwide routinely offe...y patients the opportunity to join their child,s m...
Breaking Medicine News(10 mins):Health News:Harm Reduction for Alcohol: An Idea Whose Time Has Arrived 2Health News:USPSTF Mammography Recommendations Should Be Specifically Excluded From Health Care Reform Legislation 2Health News:USPSTF Mammography Recommendations Should Be Specifically Excluded From Health Care Reform Legislation 3Health News:New device enables early detection of cancerous skin tumors -- Ben Gurion U. 2Health News:Involving family in medical rounds benefits both family and medical team 2Health News:Involving family in medical rounds benefits both family and medical team 3Health News:Involving family in medical rounds benefits both family and medical team 4
(Date:11/24/2009)... protein that may help gut bacteria bind to the ga... probiotic producers to identify strains that are ...tics need to interact with cells lining the gut to...urfaces in the gut they are more likely to stick a...r Nathalie Juge from the Institute of Food Researc...
(Date:11/24/2009)...mber 24, 2009) -- The Wildlife Conservation Societ...e last remaining population of Siberian tigers has...ide of poaching and habitat loss. , ...ials of what needs to be done to protect remaining... The report was released by the Siberian Ti...
(Date:11/24/2009)... Spanish . , The presence of increased body ...ubstances in the blood, hinders the loss and maint...ect of the University of Navarra conducted by Estb... Pharmacy. , The project, entitled "A nutrigenet...ol of body weight and inflammation," examines how ...
Breaking Biology News(10 mins):A sticky solution for identifying effective probiotics 2Report shows dramatic decline in Siberian tigers 2It can be predicted the reaction obese patients will have to a diet 2Shrinking Bylot Island glaciers tell story of climate change 9745 1Shrinking Bylot Island glaciers tell story of climate change 9745 2Shrinking Bylot Island glaciers tell story of climate change 9745 3Shrinking Bylot Island glaciers tell story of climate change 9745 4Kaiser Workers Statewide Campaign Starts Tuesday 55751 1Kaiser Workers Statewide Campaign Starts Tuesday 55751 2This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 1This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 2This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 3This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 4
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria