Navigation Links


Prescription in Medical News

Partnership for Prescription Assistance Prepared to Help New Jersey Workers Hurt by Recession

NEWARK, N.J., Aug. 6 /PRNewswire-USNewswire / -- The 'Help Is Here Express' bus tour will be stopping in New Jersey throughout the week of August 9-15 at various cities in order to help uninsured and financially-struggling New Jersey residents access information on programs that pr...

Partnership for Prescription Assistance Prepared to Help New York Workers Hurt by Recession

ALBANY, N.Y., July 31 /PRNewswire-USNewswire/ -- The 'Help is Here Express' bus tour will be stopping in New York throughout the week of August 3 - 7 at various cities in order to help uninsured and financially-struggling New Yorkers access information on programs that provide prescrip...

The State of Louisiana and Together Rx Access Join Forces to Improve Prescription Access for Uninsured Residents

BATON ROUGE, La. and ALEXANDRIA, Va., July 28 /PRNewswire/ -- The State of Louisiana and Together Rx Access announced today the launch of the Together Rx Access(R) FOR LOUISIANA Card to help thousands of eligible uninsured Louisianans access immediate and meaningful savings on pre...

ChristianPF.com Offers Four Tips to Lower Prescription Drug Costs

ST. LOUIS, July 24 /PRNewswire/ -- Financial blog, ChristianPF, published an article discussing four ways to spend less on prescription drugs. In the midst of the economic downturn, these suggestions are particularly valuable to those struggling to pay their medical bills. The a...

Partnership for Prescription Assistance Prepared to Help Pennsylvania Workers Hurt by Recession

PITTSBURGH, July 23 /PRNewswire-USNewswire/ -- The 'Help is Here Express' bus tour will be stopping in Pennsylvania throughout the week of July 27-31 at various cities in order to help uninsured and financially-struggling Pennsylvanians access information on programs that provide prescri...

AstraZeneca Expands Prescription Savings Program

WILMINGTON, Del., July 23 /PRNewswire-FirstCall/ -- AstraZeneca (NYSE: AZN ) announced today it is expanding its prescription savings program by immediately extending assistance to qualifying patients who have recently lost their jobs, had their incomes reduced, or experienced a change in m...

More>>

Prescription in Medical Technology

Dry Mouth Linked to Prescription and Over the Counter Drugs

BALTIMORE, July 9 /PRNewswire-USNewswire/ -- Approximately ninety-one percent of dentists say patients complaining about dry mouth are taking multiple medications, according to a nationwide member survey conducted by the Academy of General Dentistry (AGD). Dry mouth, or xerostomia , is caused by...

Mayo Clinic Proceedings: A Comprehensive Review of Addiction to Prescription Painkillers Among Patients and Physicians

ROCHESTER, Minn., July 7 /PRNewswire-USNewswire/ -- Chemical dependency and recovery in patients and physicians are closely examined in a series of articles and editorials in the July 2009 issue of Mayo Clinic Proceedings . The subject is especially timely. As the immense challenges, inclu...

HCPC Calls for Greater Healthcare Savings Through Improved Adherence to Prescription Drug Regimens

FALLS CHURCH, Va., June 22 /PRNewswire-USNewswire/ -- With today's announcement that the Pharmaceutical Research and Manufacturers of America (PhRMA) has offered to voluntarily grant some $80 billion in discounts to Medicare beneficiaries over the next decade in an effort to reduce overall healthc...

American Lung Association Study to be Published in the 'New England Journal of Medicine' Finds Prescription Heartburn Medication Does Not Control Asthma Symptoms as Previously Thought

--Practice Changing Study Calls on Doctors to Stop Prescribing Potent Heartburn Medications to Asthma Patients Without Frequent Symptoms of Gastric Reflux-- WASHINGTON, April 8 /PRNewswire-USNewswire/ -- For nearly 20 years, it was believed that severe asthma symptoms such as coughing, wheezi...

Experience Not Always the Best Prescription for Snowblowers

New study finds experience does not always keep hands injury-free LAS VEGAS, Feb. 27 /PRNewswire-USNewswire/ -- Snowblower-related injuries to the hand have been on the rise in recent years, with more than 5,000 injuries reported each year in the United States. Many of those injuries might ...

Mission Pharmacal Launches CitraNatal(R) Assure Prescription Prenatal Vitamin

Designed to ensure comfort and optimize nutrition for women and their babies SAN ANTONIO, Dec. 8 /PRNewswire/ -- Mission Pharmacal today announced the addition of CitraNatal(R) Assure to its CitraNatal(R) family of prescription prenatal vitamins. CitraNatal Assure builds on the benefits ...
Prescription in Medical Products

Intacs Prescription Inserts

Description: Intacs prescription inserts are an ophthalmologic medical device designed for the reduction or elimination of myopia from -1.00 to -3.00 diopters.* When placed in the corneal stroma, outside of the patient's central optical zone, the product reshapes the anterior surface of the cornea. Intacs inser...
Company:Addition Technology Inc.

Lulu Guinness Eyewear

Description:...try, a timeless look of the past with a flair for contemporary design. The contemporary designs with their retro flair include a sizable collection of prescription frames and sunwear. Be a Glamour Girl!...
Company:Tura

Jhane Barnes Eyewear Collection

Description:... Bold frames made for a man. Includes an opthalmic collection that is available where prescription glasses are sold and a sunglass collection that will soon be available in fine stores. The collection is divided into two parts named "Jhane Barnes A...
Company:Kenmark Group

Silhouette Sun Collection

Description:...vide the most comfortable, lightweight sun protection short of staying inside. The best feature of this incredible sunwear, however, is its individual prescription capabilities, providing the ultimate in outdoor comfort, protection and style....
Company:Silhouette Optical

Marc Jacobs Eyewear

Description:... Marc Jacobs is pleased to present his very first collection in collaboration with Safilo Group, unveiling a range of sunglasses and prescription frames that are defined by clean, linear design and with sophisticated, unusual and original details. The sung...
Company:Safilo Group

Keeler Sport Frames

Description:...nd attractive, the new Keeler Sport frame is available in a choice of bright colors. The Keeler Sport frame can be worn over your own glasses, or your prescription can be incorporated into the supplied holder....
Company:Keeler Instruments Inc.
Prescription in Medical Definition

Private prescription

A private prescription is a United Kingdom Medical term that refers to a prescription funded by the patient, rather than the National Health Service . Unlike NHS prescriptions, a private prescription can be written on any piece of paper and a doctor may also write their own private pres...

Medical procedure

...cal test Physical examination Contraindication Complication (medicine) Drug interaction Iatrogenesis Medical error Medical prescription Nocebo Responsible drug use Vital signs Consensus (medical) Guideline (medical) Algorithm (medical) ...

Medicine

...tions. Physicians have been accorded gradually higher status and respect over the last century, and they have been entrusted with control of access to prescription medicines as a public health measure. This represents a concentration of power and carries both advantages and disadvantages to particular kinds of pa...

Pharmaconomist

...ology , medicine , veterinary medicine , zoology , diagnosis , medical prescription , pharmacy law , medical sociology , patient safety , health care , ps...ense, sell and provide information about medical prescriptions and about prescription medicine and over-the-counter medicine (OTC) . The pharmaconomist also ...
Prescription in Medical Dictionary

Prescription

A prescription (℞) is a health-care program implemented by a physician or other medical practitioner in the form of instructions that govern the plan of care for an individual patient. Prescriptions may include orders to be... A prescription drug is a licensed medicine that is regulated...

VIP

..... Us | Contact Us © 2008 VIP Communications Inc. All Rights Reserved. ... Distributor of wholesale generic pharmaceuticals, including OTC's, prescription medicines and more, to independent pharmacists and chain pharmacies in the U.S. ... ...

Vasodilation

...e presence of both prazosin ... Nitrosyl factors mediate active neurogenic hindquarter vasodilation in the conscious rat. ... Learn about the prescription medication Tiazac (Diltiazem Hcl), drug uses, dosage, side effects, drug ... vasodilation . 1 (2) 5 (3) 1 (2) dyspepsia. 0 (0) ... ...

Typhus

... diagnosis, misdiagnosis, treatment, causes, patient stories, videos, forums, prevention, and prognosis. Treatments for Typhus including drugs, prescription medications, alternative treatments, ... Online Books for Typhus . FEVER, ACUTE (Algorithmic Diagnosis ... Causative Agent: Typhus fever is ...

Tuberculin

...berculin reaction increases the likelihood of any ... Learn about the prescription medication Tubersol ( Tuberculin Purified Protein), drug uses, dosage, ..., drug interactions, warnings, and patient labeling. Learn about the prescription medication Mono-Vacc ( Tuberculin (mono-vaccine)), drug uses, dosage, s...

Tolmetin

...atoid arthritis, including juvenile rheumatoid... Drug information on prescription and over the counter medications includes drug interactions, uses, side ... risk will increase the longer you use tolmetin . ... Learn about the prescription medication Tolectin ( Tolmetin Sodium), drug uses, dosage, side effects...
Prescription in Biological News

Trends in prescription medication sharing among reproductive-aged women

New Rochelle, NY, August 25, 2008Borrowing and sharing of prescription medications is a serious medical and public health concern. A survey of nearly 7,500 women of reproductive age found that this is common practice among more than one-third of this population, according to a report published on...

Physical activity and health: Finding the right prescription

This release is available in French . Saskatoon (November 3, 2008) We all know physical activity is good for you. But why exactly is it good for you? What effect does exercise have on the cells and tissues of the body? What do we need to know so that we can use physical activity more effe...

Efficiency, not more doctors, is the prescription for aging population

Recent news reports that threaten a shortage of doctors to treat the burgeoning elderly population are wrong, according to researchers at Dartmouth Medical School's Center for the Evaluative Clinical Sciences (CECS). In a study published in the March/April issue of Health Affairs, they argue that ...

Earth Rx: A microbial biotechnology prescription for global environmental health

Water. Waste. Energy. This trio of problems is among the greatest challenges to the environmental health of society. Water purification alone is becoming more problematic in the world due to our increasingly reliance on contaminated sources, such as polluted rivers, lakes and groundwater. "Al...

Genetic tests advertised directly to the consumer

...ng to the article, "Direct-to-Consumer/Patient Advertising of Genetic Testing: A Position Statement of the American College of Clinical Pharmacology," prescription medications have been advertised in the US for 10+ years with a defined oversight of the process, however, there's no comparable supervision for adver...

Infant formula adulteration with melamine underscores need for better detection methods

...toothpaste and cough syrup. USP is a scientific nonprofit organization that sets official standards for the identity, quality, purity, and strength of prescription and over-the-counter drugs. USP also sets widely recognized standards for the quality and purity of food ingredients and dietary supplements. "This...
Prescription in Biological Technology

Global Prescription Drugs Market to Cross $897 Billion by 2015, According to New Report by Global Industry Analysts, Inc.

GIA announces the release of a comprehensive global report on Prescription Drugs market. The global prescription drugs market is witnessing a significant deceleration in growth. Key factors slowing down growth in the global prescription drugs market include economic downturn, increasing number of...

New Pleio Medication Adherence Service Increases Prescription Refills Up To 53%

Pleio GoodStart(tm) improves compliance and persistence with chronic medications. Prescription refills increase up to 53% during patients' first 100 days of therapy. New free service offers coaching, reminders and pharmacist support to alleviate stress and confusion some patients experience while...

Bio-Tech Medical Software, Inc. Biometrics Joins Forces with the University of Central Florida to Fight Diversion and Help Combat Prescription Narcotic Drug Abuse

Pilot Program in Fort Lauderdale helps to Leverage Bio-Tech Medical Software, Inc. with the University of Central Florida. Bio-Tech Medical Software, Inc., will utilize UCF's biometrics, elite technology and other programming techniques in an effort to establish the best prescription monitoring pr...

Cephalon Launches National Consumer Awareness Initiative on Appropriate Use of Prescription Opioid Medications

Former Director of the Office of National Drug Control Policy to Moderate First Educational Webinar: When Good Medicines Become Bad Drugs FRAZER, Pa., Oct. 14 /PRNewswire-FirstCall/ -- Cephalon, Inc. (Nasdaq: CEPH) announced today that it is embarking on a national educational program design...

AstraZeneca Survey: Healthcare Professionals Leading Source of Information on Company's Prescription Savings Programs

WILMINGTON, Del., July 23 /PRNewswire-FirstCall/ -- More than a third of the people who contacted AstraZeneca (NYSE: AZN ) to inquire about the company's prescription savings programs learned of the programs from their doctors or pharmacists, according to a year-long survey of more than 12,00...

InnovationRx, a Prescription Adherence Solutions Company, and InforMedix Partner to Market and Sell End-to-End Medication Adherence Solutions

ROCKVILLE, Md. and NEWTON, Mass., April 17 /PRNewswire-FirstCall/ -- InforMedix Holdings, Inc. (OTC Bulletin Board: IFMX), providing Med-ePhone(TM), Med-eMonitor(TM), and Med-eXpert(TM) Systems to improve medication adherence and health status monitoring, and InnovationRx, a provider of prescr...
Prescription in Biological Definition

Dialysis

...ysis, or (rarely) it can be done in the patient's home. Nurses and technicians working in the facility have special training specific to dialysis. A prescription for dialysis by the renal physician (nephrologist) will specify various parameters for setting up dialysis machines, times and durations of dialysis s...

Drug

...ly a drug directly to patients , authorized by a prescription from a medical professional, if the drug can be s... price to drop markedly. Drugs which don't require prescription by a medical professional are known as over-the-co... (illegal in US since Jan 2004) Taurine prescription drugs , prohibited for non-medical use: Coca...

Eye

... Accommodation Binocular vision Crystallin Evil eye Evolution of the Eye Eye color Eye contact Eye tracking Eyeglass prescription Macropsia Micropsia Nictating membrane Ocular tremor Optometry Ophthalmology Persistence of vision Saccade Snellen...

Selective serotonin reuptake inhibitor

...ting with tryptophan will. In 1989, the FDA made tryptophan available by prescription only, in response to an outbreak of eosinophilia-myalgia syndrome caused...HTP supplements instead of SSRIs In mid 2004, a Congressional hearing on prescription drugs noted that 1 in 6 children in the United States are being prescribed ...
Prescription in Biological Dictionary

Synapton

... > News & Publications > Journals > ... Physostigmine ( Synapton )* Phase 3 trials completed. Cholinesterase inhibitor. Xanomeline ... prescription drugs starting with the letter S. Discuss one ... Synapton Physostigmine. New Discussion. Synarel Nafarelin. New Discussion. Synemol Fluocinolone .....

Polysaccharide

...charide - any of a class of carbohydrates whose ... Learn about the prescription medication Typhim (Typhoid Vi Polysaccharide Vaccine), drug uses, dosage,...ects, drug interactions, warnings, and patient labeling. Learn about the prescription medication Menomune (Meningococcal Polysaccharide Vaccine), drug uses, do...

Ovules

...ccurate, FDA approved Cleocin Vaginal Ovules information for healthcare professionals and patients - brought to you by Drugs.com. Learn about the prescription medication Cleocin Vaginal Ovules (Clindamycin Phosphate Vaginal Suppositories), drug uses, dosage, side effects, drug interactions, ... Shop for...

Norepinephrine

...lth care provider before receiving norepinephrine ? ... Learn about the prescription medication Levophed ( Norepinephrine Bitartrate), drug uses, dosage, side ...norepinephrine but probably even shorter acting ... Read more about the prescription drug NOREPINEPHRINE BITARTRATE... norepinephrine bitartrate-injection I...

Intron

... it works and what life may be like during treatment. ... Treatment with INTRON ® A. Managing Side Effects. Understanding Your ... Learn about the prescription medication Intron A (Interferon alfa-2b, Recombinant for Injection), drug uses, dosage, side effects, drug interactions, warnings, and ... Intro...

Insulin

..., a drug used for the treatment of type 1 and type 2 diabetes mellitus. ... Insulin is required by the cells of the body in ... Learn about the prescription medication Humulin N ( Insulin (Human Recombinant)), drug uses, dosage, side effects, drug interactions, warnings, and patient labeling. Quick Lin...
Other TagsArterieMalaysWarneNevNevNev
(Date:11/30/2009)...30 At a briefing of the...and the Consortium for Citizens with Disabilities ...ic Policy and Advocacy for NCOA, called on Congres...sponds to the growing crisis in long-term care for...ns of seniors, after working hard all their lives,...
(Date:11/30/2009)...mic is far from over. Every year, almost three mi...lion die from AIDS-related diseases." ,, WASHI... AIDS Day 2009 the Global AIDS Alliance (GAA) call...n two recent alarming reports from the World Healt...c continues to be of catastrophic proportion, affe...
(Date:11/30/2009)...g significant impact, CBO analysis understates the...ewswire/ -- The Blue Cross and Blue Shield Assoc...rding the estimate released today by the Congressi...irmed what many economists, actuaries, and health ...lthcare reform bill would make coverage more expen...
(Date:11/30/2009)...s equivalent to 113 chest X-rays, study finds , ... than half of patients who have abdominal/pelvic C...ts that expose them to extra radiation, U.S. resea...d pelvic series were performed on 500 patients age...30 to 50 years of age. The researchers concluded t...
(Date:11/30/2009)... 30 SEIU Local 21LA mem...ration Sodexo will hold a rally Tuesday, Dec. 1, 2...headquarters, 3800 Desire Parkway, New Orleans, to...y disciplinary policies that target employees who ...er. Sodexo employees who clean schools in the Reco...
Breaking Medicine News(10 mins):Health News:NCOA, Bedlin Brief Leading Aging Organizations on Health Care Reform, Needed Long-Term Care Provisions 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 3Health News:CBO Confirms That Premiums Will Increase Under the Senate Healthcare Reform Bill 2Health News:CT Scan Patients May Get Unnecessary Imaging 2Health News:As H1NI Hits New Orleans in Force: School Custodians to Hold Rally to Call on Contractor to Stop Penalizing Workers Coping With Illness 2
(Date:11/30/2009)...ratures continue to rise scientists are presented ...ecies respond and adapt. In a paper published in ...odriguez-Trelles and Dr Miguel Rodriguez assess th... of approximately 0.6˚C has already affected ...ng ecologists and evolutionary biologists is to pr...
(Date:11/30/2009)...report published in the December 2009 print issue ...lar type of control over their fertility that wome...sts have found how and where androgenic hormones w...on and male fertility. This opens a promising aven...discovery also offers hope to those who cannot hav...
(Date:11/26/2009)...r impressive antlers, red deer have been caught in... antlers are much more than decorative. They are l...ing. John Currey, from The University of York, UK,...f bone for over half a century and has become fasc...ugh a long-standing collaboration with Tomas Lande...
Breaking Biology News(10 mins):How can scientists measure evolutionary responses to climate change? 2Tough yet stiff deer antler is materials scientist's dream 2Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 1Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 2Hologic to Present at the 29th Annual Canaccord Adams Global Growth Conference 51475 1Hush little baby Linking genes brain and behavior in children 9237 1Hush little baby Linking genes brain and behavior in children 9237 2
Other Contentsridgeridgemicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadaches