Navigation Links


ppp at Biology News

ppp at Biology Products

G(5)ppp(5)G from Ambion

Description:...
Company:

m7G(5)ppp(5)G (Cap Analog) from Ambion

Description:m7G(5')ppp(5')G (Cap Analog) is used for the synthesis of 5' capped RNA molecules in in vitro transcription reactions. Substitution of cap analog for a large portion of the GTP in an in vitro transcription reaction results in the incorporation of the cap structure into a large fraction of the transcripts. Capped mRNAs are generally translated more efficiently in reticulocyte lysate and wheat germ...
Company:Ambion

m7G(5)ppp(5)G (Cap Analog) from Ambion

Description:m7G(5')ppp(5')G (Cap Analog) is used for the synthesis of 5' capped RNA molecules in in vitro transcription reactions. Substitution of cap analog for a large portion of the GTP in an in vitro transcription reaction results in the incorporation of the cap structure into a large fraction of the transcripts. Capped mRNAs are generally translated more efficiently in reticulocyte lysate and wheat germ...
Company:Ambion

Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant PPP4C. GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*...
Company:Abnova Corporation

Mouse Anti-Human PPP2R2C Monoclonal Antibody, Unconjugated, Clone 6D1 from Novus Biologicals

Description:Mouse monoclonal antibody to PPP2R2C - protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform...
Company:Novus Biologicals

More>>

ppp at Biology Technology

Mx4000 Multiplex Quantitative PCR System*,PPP

Stratagene has improved upon currently available QPCR machines with the Mx4000 multiplex quantitative PCR system. This new system offers better performance and functionality at a more economical price. Real-time quantitative PCR (QPCR) allows researchers to quickly and easilyquantify nuclei...
ppp at Medicine News
ppp at Medicine Products

Appasamy Phaco Choppper

Description:1.5 mm inner cutting edge....
Company:Appasamy Associates
ppp at Medicine Technology
Other TagsStabilizedPharmacisMultimodalSimiSimi
(Date:7/25/2008)...ON, July 25 /PRNewswire/ -- The Elekta Family of C... treatment solutions at the 2008,American Associat...g,demonstrating how the joint forces of Elekta, I... therapy planning and delivery solutions that,stre...perience for,patients, as well as enhance clinicia...
(Date:7/25/2008)...ds fluid back-up in esophagus can cause immune sys...ay News) -- The first evidence linking gastroesoph...scovered by Duke University Medical Center researc...ns was first noted in the 1970s, and since then st...rcent of asthma patients also experience GERD symp...
(Date:7/25/2008)... The Retina Group of New York will...ted macular degeneration especially designed for s...e Public Library at 116 Merritts Road, Farmingdale.... Attendance is free and refreshments will be prov...6) 939-6100. , Hicksville...
(Date:7/25/2008)... This donation will be used to fac...ve services for children , ... ( www.ivci.com ), a leading integrator of enterp...tion video conferencing, telepresence, audio visua...announced today that it has donated video conferen...
Breaking Medicine News(10 mins):Health News:Elekta Family of Companies to Highlight Cancer Treatment Solutions at 2008 AAPM Annual Meeting 2Health News:Elekta Family of Companies to Highlight Cancer Treatment Solutions at 2008 AAPM Annual Meeting 3Health News:People With GERD More Likely to Develop Asthma 2Health News:Retina Group of New York To Present Seminar on Age-Related Macular Degeneration; The Leading Cause of Visual Loss in Seniors 2Health News:Retina Group of New York To Present Seminar on Age-Related Macular Degeneration; The Leading Cause of Visual Loss in Seniors 3Health News:Mt. Sinai's Children's Trauma Institute Treatment and Service Adaptation Center Receives Video Conferencing Donation From IVCi 2
(Date:7/24/2008)..., Irvine, Calif. UC Irvine researchers have foun...own body clock and metabolism. The discovery reve...s, obesity and other related diseases. , Paolo S... Pharmacology, and his colleagues have identified ...tes the body,s circadian rhythms, works in balance...
(Date:7/24/2008)... PORTLAND, Ore. July 23, 2008. A fire is currently...re made about fire behavior about 2 years ago. Man...-Successional Reserve (LSR) study in the planning,...here the Cold Springs fire is now active., The G...Range in Washington, and covers about 15,000 acres...
(Date:7/23/2008)... COLUMBUS, Ohio Wealthy nations willing to collec...nt the emission of roughly half a billion metric t...rs, new research suggests. , It would take abou...tropical deforestation in the world, one of the to...chers estimate. , If adopted, this type of progr...
(Date:7/23/2008)... (Santa Barbara, Calif.) - In a study of free-livi... Pacific coast of California and Baja California, ...ornia, Santa Barbara, the United States Geological...hat parasite biomass in those habitats exceeds tha...0. Their findings, which could have significant bi...
Breaking Biology News(10 mins):Circadian rhythm-metabolism link discovered 2Landscape study may offer solutions for fire managers 2Paying to save tropical forests could be a way to reduce global carbon emissions 2Paying to save tropical forests could be a way to reduce global carbon emissions 3Paying to save tropical forests could be a way to reduce global carbon emissions 4Study shows parasites outweigh predators 2Study shows parasites outweigh predators 3Author 26 Radio Host Tim Kellis Charges Psychologists Who Write Relationship Books are Helping to Spawn a Divorce Industry 22296 1Author 26 Radio Host Tim Kellis Charges Psychologists Who Write Relationship Books are Helping to Spawn a Divorce Industry 22296 2Cardiums InnerCool Therapies Unit Announces Italian Commercialization Agreement for Portfolio of Temperature Modulation Systems 6107 1Cardiums InnerCool Therapies Unit Announces Italian Commercialization Agreement for Portfolio of Temperature Modulation Systems 6107 2Cardiums InnerCool Therapies Unit Announces Italian Commercialization Agreement for Portfolio of Temperature Modulation Systems 6107 3Cardiums InnerCool Therapies Unit Announces Italian Commercialization Agreement for Portfolio of Temperature Modulation Systems 6107 4Cardiums InnerCool Therapies Unit Announces Italian Commercialization Agreement for Portfolio of Temperature Modulation Systems 6107 5Cardiums InnerCool Therapies Unit Announces Italian Commercialization Agreement for Portfolio of Temperature Modulation Systems 6107 6Tuna populations at risk 3702 1Tuna populations at risk 3702 2Perspective 3A Policies must keep pace with genetic progress 3698 1Perspective 3A Policies must keep pace with genetic progress 3698 2
Other Contentssodiumsodiumsodiumsodiumsodiumsodiumsodiumsodiumsodiumsomatizationthroatsthroatsthroatssoresoresoresoresoresoysoysoysoyspecimenspecimenspecimenspecimenspecimenspecimenspecimenspecimenspecimenspasmodicspasmodic