m7G(5)ppp(5)G (Cap Analog) from Ambion
Description:m7G(5')ppp(5')G (Cap Analog) is used for the synthesis of 5' capped RNA molecules in in vitro transcription reactions. Substitution of cap analog for a large portion of the GTP in an in vitro transcription reaction results in the incorporation of the cap structure into a large fraction of the transcripts. Capped mRNAs are generally translated more efficiently in reticulocyte lysate and wheat germ...m7G(5)ppp(5)G (Cap Analog) from Ambion
Description:m7G(5')ppp(5')G (Cap Analog) is used for the synthesis of 5' capped RNA molecules in in vitro transcription reactions. Substitution of cap analog for a large portion of the GTP in an in vitro transcription reaction results in the incorporation of the cap structure into a large fraction of the transcripts. Capped mRNAs are generally translated more efficiently in reticulocyte lysate and wheat germ...Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Description:Mouse polyclonal antibody raised against a partial recombinant PPP4C. GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*...Mouse Anti-Human PPP2R2C Monoclonal Antibody, Unconjugated, Clone 6D1 from Novus Biologicals
Description:Mouse monoclonal antibody to PPP2R2C - protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), gamma isoform...Mx4000 Multiplex Quantitative PCR System*,PPP
Stratagene has improved upon currently available QPCR machines with the Mx4000 multiplex quantitative PCR system. This new system offers better performance and functionality at a more economical price. Real-time quantitative PCR (QPCR) allows researchers to quickly and easilyquantify nuclei...