Navigation Links


Nodules in Medical News

A guided broncoscope achieves biopsy of 75 percent pulmonary nodules without puncture or surgery

The release is available in Spanish . A broncoscope guided by means of electromagnetic navigation has managed to achieve the biopsy of 75% of pulmonary nodules greater than 2 cm, according to Doctor Luis Seijo, specialist in Pneumology at the University Hospital of Navarra. This is the hosp...

Microcoils help locate small lung nodules

OAK BROOK, Ill. - A new technique combining computed tomography (CT) with fiber-coated surgical microcoils allows physicians to successfully locate and remove small lung nodules without the need for a more invasive procedure, according to a new study published in the February issue of Radiology ....

Protein Helps ID Thyroid Cancer Nodules

Test using galectin-3 finds them sooner, could cut unnecessary surgeries MONDAY, May 19 (HealthDay News) -- Testing thyroid nodules for the presence of a lectin molecule called galectin-3 could help improve identification of nodules with cancer and reduce the number of unnecessary sur...

PET outperforms CT in characterization of lung nodules

Reston, Va.Researchers involved in a large, multi-institutional study comparing the accuracy of positron emission tomography (PET) and computed tomography (CT) in the characterization of lung nodules found that PET was far more reliable in detecting whether or not a nodule was malignant. CT and ...

CAD plus MDCT useful in finding lung nodules

Computer-aided detection combined with MDCT improves radiologists ability to detect solid lung nodules early enough for them to be treated without increasing interpretation time according to a recent study conducted by researchers at Hopital Pitie-Salpetriere in Paris, France. The comparison of...

Hormonal Therapies Offer Effective Solutions for Many Adult Women With Acne

...apy in the form of combination oral contraceptive pills has been shown to help treat both inflammatory acne lesions (the papules, pustules and painful nodules under the skin), and non-inflammatory acne lesions (blackheads and whiteheads). Dr. Schlosser suggests that hormonal therapy should not be used in iso...

Adenoviral vector specifically targeted to EphA2 receptor in pancreatic cancer cells

...n a subsequent in vivo study of a nude (nu/nu ) mouse model however, no increased adenoviral targeting to subcutaneously growing human pancreas cancer nodules was seen upon injection into the tail vein, nor upon injection into the peritoneum. Although re-directing of the adenoviral vector has been reporte...

Ultrasound can help low-risk patients avoid invasive thyroid biopsy

... The prevalence of benign thyroid nodules is high and there are certain ultrasound features,... showing that some sonographic features of thyroid nodules are suggestive of malignant nature and should lead...o 10 mm," said Dr. Sellami. "Very few thyroid nodules are obviously malignant or benign. Most thyroid...

Early-stage lung cancer identified using computer-aided system

...thod may help radiologists identify cancerous lung nodules at an early stage, according to a study performed ... Baltimore, MD. "In our study we identified 88 nodules that were not detected at the time of interpretati...r of the study. "CAD was applied to the overlooked nodules and we found that 45-55% of the missed...

Singers Hit High Notes in Free Voice Screening at The New York Eye and Ear Infirmary

...ch can be used as a base line reference for future exams. More than half of the 45 singers who came discovered they had vocal problems resulting from nodules and polyps on their vocal folds, atrophy, muscle tension dysphonia or acid reflux. Included in each singer's take-home packet was a voice conse...
Nodules in Medical Technology

Archimedes Pharma Announces Successful Proof-of-Concept Results on Two Intranasal Development Projects

...py for patients and carers include the need for multiple injections, which can be painful and are often associated with the development of troublesome nodules at the injection site, and the requirement for a degree of manual dexterity that some PD patients find difficult. IN Apomorphine, an innovative aqueou...

Ardea Biosciences Advances Lead Product Candidate for the Treatment of Gout, RDEA594, Into Phase 1 Clinical Trial

...tion of uric acid crystals in and around the connective tissue of the joints and in the kidneys, leading to inflammation, the formation of disfiguring nodules (tophi), intermittent attacks of severe pain (acute flares), and kidney damage (nephropathy). While gout is a treatable condition, there are limited t...

Auxilium Pharmaceuticals, Inc. Announces XIAFLEX(TM) Meets Primary Endpoint With Statistical Significance (p<0.001) in CORD I Pivotal Phase III Study for Dupuytren's Contracture

...ure is a condition that affects the connective tissue that lies beneath the skin in the palm. The disease is progressive in nature. Typically, painful nodules develop in the palm as collagen deposits accumulate. As the disease progresses, the collagen deposits form a cord that stretches from the palm of the ...

Ardea Biosciences, Inc. Announces New Clinical Development Program Directed Toward the Treatment of Gout

...tion of uric acid crystals in and around the connective tissue of the joints and in the kidneys, leading to inflammation, the formation of disfiguring nodules (tophi), intermittent attacks of severe pain (acute flares), and kidney damage (nephropathy). An estimated 3-5 million people in the U.S. suffer from ...

Cleveland Clinic Leading Clinical Program to Improve Early-Stage Lung Cancer Detection

...ay CAD. Forty-two percent and 22 percent of nodules sized 9-14 mm and 20-27 mm, respectively, were ...detects 16 percent more solitary pulmonary nodules that may be early-stage lung cancer than a...ifying features associated with solitary pulmonary nodules that could represent early-stage lung cancer and r...

It's Only Heartburn...or is it? Chronic Heartburn a Risk Factor for Precursor to Esophageal Cancer

...cedures to repair hiatal hernias and to prevent acid reflux, radiofrequency ablation to destroy abnormal cells, endoscopic mucosal resection to remove nodules within Barrett's esophagus, and esophageal cancer surgery. Robert J. Korst, M.D., Medical Director of The Valley Hospital's Daniel and Gloria Blumen...
Nodules in Medical Products

LumboTrain

Features:...upport incorporating an adjustable, anatomically contoured silicone insert stabilizes and relaxes the lower back muscles Silicone insert with raised nodules provides intermittent compression to the soft tissue, leading to increased circulation, and allowing for unicompartmental movement Intermittent comp...
Company:Bauerfeind USA, Inc.
Nodules in Medical Dictionary

Nodules

... most likely to develop nodules . The nodules appear as symmetrical swellings on ... Vocal cord nodules , although they can certainly impair one's speaking and ... Nodules may form on tendons and muscles in response to injury. ... Nodules are normally benign and oft...

Thyroxine

...id disease, treatment therapies and prevention, ... of Thyroxine . Menopause and Perimenopause Slideshow. Thyroxine : Abbreviated ... Thyroid nodules &mdash; Comprehensive overview covers symptoms, causes, ... Your thyroid gland produces two main hormones, thyroxine and triiodothyronine. .....

Thyroid gland

...yroid gland must be removed. ... Thyroid nodules — Comprehensive overview covers symptoms, causes,... is otherwise apparently normal ... Thyroid nodules affect approximately 10% of the population, being far more ... Thyroid nodules are small tumor-like growths on the thyroid gl...

Thyroid diseases

...ented by local chapters, free to members and the public. ... Learn about thyroid disease symptoms such as an enlarged thyroid and thyroid nodules at Hormone.org, the website of the Hormone Foundation. List of 4 disease causes of Thyroid disease , patient stories, diagnostic guides, ......

Thyroid disease

... Nodules, Thyroiditis, Goiters. Related Tests: TSH, T3, T4. Learn about thyroid disease symptoms such as an enlarged thyroid and thyroid nodules at Hormone.org, the website of the Hormone Foundation. Graves' disease n. A condition usually caused by excessive production of thyroid horm...

Thyroid scan

...cine examination that uses the emissions of ... When thyroid cancer or nodules are suspected. ... Texas Health Resources, North Texas; Thyroid sca...ation. ... doctor may want to obtain a thyroid scan to determine which nodules should be ... A thyroid scan is a nuclear medicine examination tha...

Sarcoidosis

...atment, and more, from the WACH FOX 57. User-edited article about sarcoidosis , the immune system disorder characterized by small inflammatory nodules commonly seen in young adults. Features causes, risk factors, screening and diagnosis, and treatment. Sarcoidosis is a multiorgan disease ...

Pneumoconiosis

... Pneumoconiosis in combination with multiple pulmonary rheumatoid nodules in ... Pneumoconiosis (Asbestosis, Baritosis, Bauxite fibrosis, Berylliosis, Caplan's ... Basic information about the respiratory dise...

Nephrocalcinosis

...number of conditions: ... Nephrocalcinosis refers to increased calcium content of the kidneys. ... In medullary nephrocalcinosis , calcium nodules commonly rupture into the ... Nephrocalcinosis information center covers causes, prevention, symptoms, ... Nephrocalcinosis may therefore b...

Keloid

...the word " keloid ," it is both a noun, and a verb. The verb, "to keloid " means to create these raised scars. ... Keloids are raised, reddish nodules that develop at the site of an injury.After ... For severe cases, the keloid can surgically excised and given x-ray treatments ... Keloid : ...
Nodules in Biological News

Fossil bone bed helps reconstruct life along California's ancient coastline

...s look a bit rotten," Lipps said, "as if they lay on the seafloor for a long time and were abraded by water with sand in it." Many bones had manganese nodules and growths, which form on bones that sit for long periods in sea water before being covered by sediment. Toward the top of the bone bed, some arti...

American Chemical Society's Weekly PressPac -- June 3, 2009

... Other possibilities include mining new sources of metals, such as those found in metal sulfide deposits near deep-sea hydrothermal vents or manganese nodules found in deep-sea sediments. While such innovative mining approaches are expensive and not practical today, new technology may enable their use in the...

Rensselaer receives more than $2 million from New York State to fund stem cell research

...very important in controlling the formation of both brain and bone stem cells. Mutation of these genes results in abnormal stem cell growth leading to nodules in the neurons of the brain, a condition known as periventricular heterotopia and a progressive shortening of bones known as skeletal chondrodysplasia...

Computation and genomics data drive bacterial research into new golden age

... Kondorosi from the Institut des Sciences du Vgtal in Gif sur Yvette in France, showed that the process by which the Rhizobium bacteria in legume root nodules adapt to their nitrogen fixing role is induced, at least in part, by small peptides (proteins) made by the plant which target the bacteria in the nodu...

When threatened, a few African frogs can morph toes into claws

...ree-floating bones at their tips. Eventually he determined that these small nodules at the tips of the frogs' feet were connected to the rest of the toe by a collagen-rich sheath. "These nodules are also closely connected to the surrounding skin by dense networks of col...

Soybean varieties viable in southern Indiana, resistant to root-knot nematode

...h bigger than the signs caused by the soybean cyst nematode. The nematode galls have irregular tumorlike shapes, in contrast to the spherical shape of nodules caused by rhizobium association. Next the researchers will try to determine varieties of cover crops that are nematode-resistant. Cover crops are ...

A common genetic mechanism discovered in nitrogen-fixing plants

...duced. Subsequent comparison of these plants ability to form symbiotic root nodules with that of control plants showed that the plants with lowered SymRK gene expression produced only half as many root nodules as the controls. The same modified individuals also showed strongly reduced...

Prostate cancer: Watchful wait or vaccinate?

... died of the disease. Researchers found that mice in the experimental group had all developed very small tumors that did not progress. There were tiny nodules of prostate cancer in the mice that were surrounded by an army of immune system cells, Kast said. The vaccination turned the cancer into a chronic, ma...

Cleveland Clinic leading clinical program to improve early-stage lung cancer detection

... findings. In previous clinical trials, Riverains chest X-ray CAD technology helped radiologists identify16 percent more 9-15 mm solitary pulmonary nodules that were early stage (1A) lung cancer than the radiologist would have otherwise detected without CAD. OnGuard™ is the only FDA-PMA approved ch...

A new plant-bacterial symbiotic mechanism promising for crop applications

... This special character confers on it the exceptional, rare ability to form nodules on the stems of its host-plant. The plant thus acquires the possibility of ...ies of nitrogen than those usually measured in leguminous plants which have nodules only on their roots. The researchers sequenced (3) the genes of two b...
Nodules in Biological Definition

Malpighian corpuscle

...ighian corpuscle . They are also known as: Renal corpuscles — the initial filtering component of nephrons in the kidneys White nodules — follicles in the white pulp of the spleen , containing many lymphocytes These structures are named after Marcello Malpighi (1628...

Meiosis

...when synapsis ends), crossing over occurs. Diplotene : synaptonemal complex dissasembles (homologous chromoses are kept together by recombination nodules ), there is cellular growth and genetic transcription (and so chromosomes are seen less condensed) Diakinesis : chromosomes condense again, Chias...
Nodules in Biological Dictionary

Recombination nodules

Synaptonemal complex and recombination nodules in wild-type Drosophila melanogaster females. ... Gene conversion, recombination nodules , and the initiation of ... Synaptonemal complex and recombination nodules in wild-type Drosophila melanogaster females. ... Recombination nod...

Zygotene

...bouquet normally seen at zygotene is a rare event. ... ( C) Zygotene . ... ( D) Zygotene . ... Examples of spreads of zygotene SCs with early nodules from each of the six ... Frequency of ENs associated with SCs and AEs during zygotene for six plant species ... At the zygotene , pachytene...

Rhizobia

... Rhizobia are soil bacteria that fix nitrogen (diazotrophy) after becoming established inside root nodules of legumes (Fabaceae). Rhizobia require a plant host; they cannot independently fix nitrogen. Morphologically, they are... Selection of rhizob...

Nodule

...ubcutis (at any level in the skin) ... Thyroid nodules , or lumps, are quite common, occurring in more th... chest x-ray or CT scan. More about Vocal Cord nodules and Polyps: Causes and symptoms Diagnosis Treatment Prognosis Prevention Resources Vocal Cord nodules and Polyps nodule n. A small knotlike protub...

Endosymbiont

...hat lives within the body or cells of another organism, i.e. forming an endosymbiosis . Examples are nitrogen-fixing bacteria which live in root nodules on legume roots, single-celled algae inside reef-building corals, and bacterial... According to this theory, these organelles originated as sep...

Endosymbiosis

...hat lives within the body or cells of another organism, i.e. forming an endosymbiosis . Examples are nitrogen-fixing bacteria which live in root nodules on legume roots, single-celled algae inside reef-building corals, and bacterial... Primary endosymbiosis involves the engulfment of a bacteri...
Other TagsApplesAltitudeOutcomeOutcomeOutcomeSupplementsLymphomaLymphomaLymphomaMedicationMedicationMedicationTennisHypertensionHypertensionHypertensionAdequateSpiritualGlaucomaGlaucomaOther Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircular