Navigation Links


neurodegenerative in Medical News

Gene's novel role may provide key to treating liver and neurodegenerative diseases

Scientists at Singapore's Bioprocessing Technology Institute (BTI) have made a novel discovery about how the gene, "Fas-apoptosis inhibitory molecule" (FAIM), protects both immune and liver cells from apoptosis, or programmed cell death. Their research is published in the current journal Cell...

Institute for Neurodegenerative Disorders Deploys OpenClinica EDC solution for Large Parkinson's Study

OpenClinica has been deployed as the electronic data capture and clinical data management system for a Parkinson's study that could involve up to 15,000 patients. New Haven, CT (PRWEB) March 12, 2009 -- The Institutive for Neurodegenerative Disorders (IND) announces tha...

Drug combinations key in treating neurodegenerative diseases

AUGUSTA, Ga. Combining the benefits of multiple drugs in a single pill may hold the key to treating neurodegenerative diseases, Medical College of Georgia researchers say. Drugs that protect neurons, for example, can be used with those targeting memory to make real progress in treating disease...

New Research Shows Chronic Stress Worsens Neurodegenerative and Inflammatory Illnesses

TORRANCE, Calif., July 29 /PRNewswire/ -- Researchers at the 115th Annual Convention of the American Psychological Association (APA), reported that chronic stress can intensify inflammation and increase a person's risk for developing central nervous system infections, neurodegenerative disease...

Sleep Disorder Linked to Neurodegenerative Conditions

Rapid eye movement disorder can involve anxiety, low attention levels and Parkinson's TUESDAY, April 15 (HealthDay News) -- Rapid eye movement (REM) sleep behavior disorder -- a condition in which people act out often violent and disturbing dreams -- is associated with anxiety, apathy,...

Penn talks at ASCB touch on cancer, neurodegenerative diseases, and MD

WASHINGTON, DC Among the 72 posters, lectures, and mini-symposia given by University of Pennsylvania researchers at the ASCB annual meeting are talks that present new research findings on the molecular workings of several types of diseases. The 47th annual meeting of the American Society of C...

Southern Research Institute's Neurodegenerative Disease Drug Discovery Program Receives National Institute of Mental Health Funding

Team will develop "probes" to aid in the search for new Alzheimer's drugs BIRMINGHAM, Ala., Oct. 1 /PRNewswire-USNewswire/ -- Southern Research Institute --- a not-for-profit organization that conducts basic and applied research in the areas of preclinical drug discovery and drug development...

New research shows how chronic stress worsens neurodegenerative disease course

SAN FRANCISCO The evidence is accumulating on how bad stress is for health. Chronic stress can intensify inflammation and increase a persons risk for developing central nervous system infections, neurodegenerative diseases, like multiple sclerosis (MS), and other inflammatory diseases, say resear...

Nervous Systems of Insects may Offer Clues on Neurodegenerative Diseases

By studying the addition of sugars to proteins a process called glycosylation in the nervous system of insects, Karen Palter, researcher of Temple University, believes she may be able to better understand neurodegenerative diseases in humans. Currently, her lab is involved in two collaborative r...

Inhaled Anesthetics Accelerate the Onset of Neurodegenerative Diseases Like Alzheimer's

Researchers have discovered that common inhaled anesthetics increase the number of amyloid plaques in the brains of animals, which might accelerate// the onset of neurodegenerative diseases like Alzheimer's. Roderic Eckenhoff, MD, Vice Chair of Research in the University of Pennsylvania's Dep...

More>>

neurodegenerative in Medical Technology

Transgenomic and Power3 Medical Complete Agreement for Exclusive License of Neurodegenerative Biomarker Test

Targets Diagnosis and Early Detection of Alzheimer's and Parkinson's Diseases OMAHA, Neb. and HOUSTON, Feb. 2 /PRNewswire-FirstCall/ -- Transgenomic, Inc. (OTC Bulletin Board: TBIO) and Power3 Medical Products, Inc. (OTC Bulletin Board: PWRM) today announced they have finalized a transaction,...

Lixte Biotechnology Holdings Announces Filing of a New Patent Application for the Use of Novel Compounds as Potential Treatment for Neurodegenerative Diseases

EAST SETAUKET, N.Y., Aug. 12 /PRNewswire-FirstCall/ -- Lixte Biotechnology Holdings, Inc. (OTC Bulletin Board: LIXT) announced today that it had filed a patent application for the use of compounds the company is developing for treatment of brain tumors as potential treatments for neurodegenera...

Gene Therapy Slows Progression of Fatal Neurodegenerative Disease in Children

NEW ROCHELLE, N.Y., May 13 /PRNewswire/ -- Gene therapy to replace the faulty CLN2 gene, which causes a neurodegenerative disease that is fatal by age 8-12 years, was able to slow significantly the rate of neurologic decline in treated children, according to a paper published online ahead of p...

Mayo Clinic Studies Find REM Sleep Behavior Disorder is Associated with Other Features of Neurodegenerative Disorders

ROCHESTER, Minn., April 15, 2008 /PRNewswire-USNewswire/ -- Three new Mayo Clinic studies find that REM (rapid eye movement) sleep behavior disorder is associated with anxiety, apathy, lower scores in attention and executive functioning, as well as symptoms of Parkinson's disease. The findings...

Resveratrol Studies Suggest Broad Implications for SIRT1 Activation in Neurodegenerative Diseases of Aging Such as Alzheimer's Disease

CAMBRIDGE, Mass.--(BUSINESS WIRE)--Jun 26, 2007 - Sirtris Pharmaceuticals, Inc. (NASDAQ: SIRT), a biopharmaceutical company focused on discovering and developing small molecule drugs to treat diseases of aging, announced today that activation of SIRT1, a member of the sirtuin family of enzymes, was...

Isis Reports Strong Financial Results and Highlights for Second Quarter of 2009

...ndations to pursue new treatments for debilitating diseases, such as severe neurodegenerative diseases. Isis was awarded a grant from the Michael J. Fox Foundatio...pment programs are focused on treating cardiovascular, metabolic and severe neurodegenerative diseases and cancer. Isis' partners are developing antisense drugs invente...

CTMM Becomes One of the World's Largest Public-Private Partnerships in Translational Medical Research

...e new techniques for the diagnosis and treatment of cancer, cardiovascular, neurodegenerative and infectious/auto-immune disease. In total, more than 100 partners from i...le early diagnosis and personalised treatment for oncology, cardiovascular, neurodegenerative and infectious/auto-immune disease - the four main areas of disease causing...

Cognition Therapeutics Closes Series A Financing to Advance Drug Candidates for Alzheimer's Disease

...ped a number of screening strategies to identify small molecules capable of blocking the central toxicity of proteins in Alzheimer's disease and other neurodegenerative diseases. These assays emphasize phenotypic or functional responses of mature primary neurons to the toxic proteins. Cognition's proprietary chemistry...

Mayo Clinic Study Finds Earliest Evidence of Memory Decline in Middle-Aged People at Genetic Risk for Alzheimer's Disease

...r more information on aging-related research and the NIA, go to www.nia.nih.gov . The NIA provides information on age-related cognitive change and neurodegenerative disease specifically at its Alzheimer's Disease Education and Referral (ADEAR) Center site at www.nia.nih.gov/Alzheimers . ...

Neuroscience Researcher Has Positive Message for International Alzheimer's Awareness Week, July 6 - 12: 'Even Though World Economy is Declining, Alzheimer's Research is Advancing'

...'s therapeutic products focus on alleviating the consequences of impaired calcium homeostasis - the imbalance of calcium ions thought to be related to neurodegenerative diseases such as Alzheimer's and Parkinson's. Web: www.quincybioscience.com ...
neurodegenerative in Medical Definition

Familial isolated vitamin e deficiency

... 9 xxx OMIM 277460 600415 DiseasesDB 30633 Familial Isolated Vitamin E Deficiency is a rare autosomal recessive neurodegenerative disease. Symptoms are much like those of Friedreich ataxia and is caused by mutations in the gene for a-tocopherol transfer protein. ...

Proteopathy

...happening?". Curr Opin Clin Nutr Metab Care 9 : 403-409. PMID 16778569 . ^ Walker LC, LeVine III H (2000). "The cerebral proteopathies: neurodegenerative disorders of protein conformation and assembly". Mol Neurobiol 21 : 83-95. PMID 11327151 . ^ Chiti F, Dobson CM (2006). "Protein misfol...
neurodegenerative in Medical Dictionary

Scrapie

...rolling Classical Scrapie (PPT) ... Identification Requirements of the National Scrapie Eradication Program for Sheep (PPT) ... Scrapie is a neurodegenerative disease, caused by a prion, that affects sheep and ... form of scrapie , which was first reported from Norway in 1998, is called Nor98. ... Sc...

Progressive Supranuclear Palsy

...alsy seems like a mouthful, but it accurately ... A description of the neurodegenerative disease called progressive supranuclear palsy . ... Progressive supranuclear palsy , or PSP, is a rare neurodegenerative ... Overview: Progressive supranuclear palsy (PSP), also known as...

Prion

...rion disease is scrapie, expressed in ... Prion diseases are fatal neurodegenerative brain disorders caused by a misfolded ... Infectious transmission of the p...s for a very small percentage of ... Prion diseases are transmissible neurodegenerative conditions that affect the ... Prion diseases include scrapie (a disea...

Prion Diseases

...ortance with the ... The human prion diseases can present as sporadic, genetic, or infectious ... Prion diseases are a group of rare fatal neurodegenerative disorders in humans ... Inherited prion diseases . ... Collinge J. Prion diseases of humans and ... The known prion diseases , all fatal...

Parkinsonism

...emor, hypokinesia, rigidity, and postural instability. The underlying causes of parkinsonism are numerous, and diagnosis can be complex. While the neurodegenerative condition Parkinson's disease (PD) is the most common cause of parkinsonism , a wide-range of other etiologies can lead to a similar set... ...

Multiple system atrophy

...efinition Multiple system atrophy (MSA) is a neurodegenerative disease characterized by parkinsonism, cerebella... ... Multiple system atrophy or MSA is a neurodegenerative disease marked by a combination of symptoms affe...h ... Multiple system atrophy (MSA) is a neurodegenerative disease marked by a ... Multiple System Atr...

Mad Cow Disease

... Bovine spongiform encephalopathy (BSE), commonly known as mad - cow disease (MCD), is a fatal, neurodegenerative disease in cattle, that causes a spongy degeneration in the brain and spinal cord. BSE has a long incubation... Get the facts on mad cow di...

Bovine Spongiform Encephalopathy

...cephalopathy (BSE), commonly known as mad-cow disease (MCD), is a fatal, neurodegenerative disease in cattle, that causes a spongy degeneration in the brain and spi...Updated: August ... Bovine spongiform encephalopathy (BSE) is a fatal neurodegenerative disease, ... BSE ( Bovine Spongiform Encephalopathy , or Mad Cow Di...

Batten

...s are used for various purposes in building construction, as well as other various fields. Batten disease is a rare, fatal autosomal recessive neurodegenerative disorder that begins in childhood. Also known as Spielmeyer-Vogt-Sjögren- Batten disease, it is the most common form of a group of disorders called n...

Amyotrophic lateral sclerosis

...disease. ALS, sometimes called Maladie de Charcot, is a progressive, fatal, neurodegenerative disease caused by the degeneration of motor neurons, the nerve cells in... Gehrig's Disease, ... Amyotrophic Lateral Sclerosis is a progressive neurodegenerative disease that ... Amyotrophic lateral sclerosis is a progressive...
neurodegenerative in Biological News

Scripps Research scientists observe human neurodegenerative disorder in fruit flies

La Jolla, CA, June 24, 2009 -- A team of scientists from The Scripps Research Institute, Katholeike Universiteit Leuven, and the University of Antwerp, Belgium, among other institutions, has created a genetically modified fruit fly that mimics key features of Charcot-Marie-Tooth disease, a common ...

New hope for treatment of neurodegenerative disorder

LOS ANGELES Researchers from the University of Southern California have taken an important first step toward protecting against Huntington disease using gene therapy. Huntington Disease is an incurable neurological disorder characterized by uncontrolled movements, emotional instability and los...

CSHL scientists clarify editing error underlying genetic neurodegenerative disease

Two molecular biologists at Cold Spring Harbor Laboratory have uncovered important new details about how a gene mutation causes a cellular editing error that results in a devastating disease called pontocerebellar hypoplasia (PCH). The new findings were published online, ahead of print, on Januar...

Mayo Clinic: Brain disorder suggests common mechanism may underlie many neurodegenerative diseases

JACKSONVILLE, Fla. A Mayo Clinic-led international consortium has found a mechanism that may help explain Parkinson's and other neurological disorders. Studying just eight families worldwide, the international team of researchers have discovered a genetic defect that results in profound depre...

3-substituted indolones as novel therapeutic compounds for neurodegenerative conditions

Neurodegenerative diseases, such as Alzheimer's disease, Parkinson's disease, and amyotrophic lateral sclerosis (ALS), disrupt the quality of life for patients, put a tremendous burden on family caregivers, and cost society billions of dollars annually. The most consistent risk factor for develop...

Iron-moving malfunction may underlie neurodegenerative diseases, aging

ANN ARBOR, Mich.---A glitch in the ability to move iron around in cells may underlie a disease known as Type IV mucolipidosis (ML4) and the suite of symptoms---mental retardation, poor vision and diminished motor abilities---that accompany it, new research at the University of Michigan shows. ...

Gene therapy slows progression of fatal neurodegenerative disease in children

New Rochelle, NY, May 13, 2008Gene therapy to replace the faulty CLN2 gene, which causes a neurodegenerative disease that is fatal by age 8-12 years, was able to slow significantly the rate of neurologic decline in treated children, according to a paper published online ahead of print in the May 2...

The accumulation of sugar in neurons may explain the origin of several neurodegenerative diseases

A phenomenon considered healthy for cells, such as the accumulation of long chains of glucose (glycogen), which tissues store for energy purposes, is harmful for neurons. Published in the latest issue of Nature Neuroscience, this finding has been made by a team of Spanish researchers led by Joan J...

Researchers identify proteins involved in new neurodegenerative syndrome

The interplay of two proteins that bind to messenger RNA, a molecule that mediates translation of the information encoded in genes into proteins, triggers the appearance of fragile X-associated tremor/ataxia syndrome (FTAX), a late-life disorder associated with the gene that causes fragile X syndr...

Stem cells act through multiple mechanisms to benefit mice with neurodegenerative disease

Human embryonic stem cells (hESCs) hold great promise for benefiting degenerative diseases, and do so by invoking multiple mechanisms. Such cells can be grown in a manner compatible with clinical use (i.e., without animal feeder layers) and even without the need for immunosuppression. These were a ...
neurodegenerative in Biological Technology

Transgenomic Signs Letter of Intent for an Agreement to Exclusive License With Option to Acquire Power3 Medical Products' Neurodegenerative Diagnostics

OMAHA, Neb. and HOUSTON, Dec. 2 /PRNewswire-FirstCall/ -- Transgenomic, Inc. (OTC Bulletin Board: TBIO) and Power3 Medical Products, Inc. (OTC Bulletin Board: PWRM) today announced that Transgenomic has signed a letter of intent to acquire exclusive rights for Power3 Medical's Neurodegenerative Bi...

UCSF and YouTube Launch Channel Dedicated to Educating the Public About Neurodegenerative Diseases

UCSF launches Internet campaign to encourage early diagnosis of dementia and participation in clinical trials. Silicon Valley's Conway, Campbell Help Scientists Harness the Power of the Internet to Transform Medical Research and Philanthropic Outreach SAN FRANCISCO, June 16 ...

PharmatrophiX, Initially Funded by the Alzheimer's Drug Discovery Foundation, Announces Exclusive Global Collaboration with Elan

...ecule compounds that show promise in treating Alzheimer's disease and other neurodegenerative conditions. (Logo: http://www.newscom.com/cgi-bin/prnh/20090805/... the features of large biological agents that could both effectively combat neurodegenerative damage and be administered orally rather than intravenously - a challenge t...

Repligen Reports First Quarter Fiscal Year 2010 Financial Results

...DAC Inhibitors for Friedreich's Ataxia We are currently developing inhibitors of histone deacetylase enzymes (HDACs) for the treatment of inherited neurodegenerative diseases such as Friedreich's ataxia. Preclinical studies have shown that specific HDAC inhibitors increase production of the protein frataxin which ...

Amicus Therapeutics Announces Second Quarter 2009 Financial Results

... Amicus continues to conduct preclinical studies in Parkinson's disease and is investing in new research aimed at evaluating disease targets for other neurodegenerative and genetic disorders. Appointment of New Director The Company announced today the election of James Barrett, Ph.D., to its Board of...

Ceregene Receives Additional Grant From Michael J. Fox Foundation to Expand Long-Term Testing of CERE-120 Patients

...Ceregene, Inc. is a San Diego-based biotechnology company focused on the delivery of nervous system growth (neurotrophic) factors for the treatment of neurodegenerative and retinal disorders using gene delivery. Ceregene's clinical programs include CERE-110, an AAV2 based vector expressing nerve growth factor that is...

SK Life Sciences has Licensed Pristima

...ds in the field of neuroscience in order to treat CNS disorders including epilepsy, depression, anxiety, schizophrenia, Parkinson's disease, and other neurodegenerative disorders. In addition to the CNS area of research, SK Life Science is working on the discovery and development of novel therapeutic compounds for th...

QRxPharma Initiates Comparative Phase 2 Proof-of-Concept Study for MoxDuo(TM) IV Pain Therapy

...nd met primary and secondary endpoints. The Company's preclinical and clinical pipeline includes other technologies in the fields of pain management, neurodegenerative disease and venomics. For more information, please visit www.QRxPharma.com . ...

Blackrock Microsystems Obtains Expanded 510(k) to Market NeuroPort System

... used in the BrainGate Neural Interface System (approved under IDE), which is designed for chronic use in people with spinal cord injuries, stroke and neurodegenerative conditions. Cyberkinetics previously obtained 510k clearance to market the NeuroPort System in April 2005, though its use at the time was limited excl...

New method may accelerate drug discovery for difficult diseases like Parkinson's

...yclic peptides into cells of a well-established yeast model of Parkinson's disease that was created in the Lindquist lab. Parkinson's disease is a neurodegenerative disorder characterized by tremors, muscle rigidity, and slowed movements. In the neural cells of Parkinson's patients' brains, researchers have noted ...
neurodegenerative in Biological Definition

Brain

...e brain, is another major cause of death and brain damage. Other problems in the brain can be more accurately classified as diseases than injuries. neurodegenerative diseases , such as Alzheimer's disease , Parkinson's disease , and Huntington's disease , are caused by the gradual death of individual neurons lea...
neurodegenerative in Biological Dictionary

Trans-splicing

... controls the production of every ... During the trans - splicing reaction, each of the mRNAs acquires the spliced ... Spinal muscular atrophy, a neurodegenerative disorder that causes the weakening of muscles, is the leading cause of ... While trans - splicing (a form of ... Destruction of U2, U4, or U6 sma...

Prion

...humans, and. Prion diseases are transmissible neurodegenerative conditions that affect the ... Prion diseases in...... The expanding realm of prion phenomena in neurodegenerative disease ... Comparative prion disease gene ex...ee online English dictionary and encyclopedia. ... neurodegenerative prion diseases are often called spongiform encep...

Native state

...three-dimensional shape that they are able to perform their biological function. In fact, shape changes in proteins are the primary cause of several neurodegenerative diseases,... ... The British Raj and the Native States . 2 Princely status and titles ... 6 A short list of Native States in 1909. 6.1 ...

Motor neuron

...al nerves have a lower motor neuron component as they are mixed nerves. ... What are Motor Neuron Diseases? Motor neuron diseases are neurodegenerative diseases that cause selective loss ... Symptoms/Signs of lower motor neuron disease ... III. MOTOR NEURON DISEASE ... Adult motor neuron...
Other Tagsnetworknetworknetworknetworkdesigneddesigneddesignedrewardrewardyetyetyetinksinksinkswhaleperformed
(Date:12/5/2009)... ,, What: Cuts for a Cause ... the fight against cancer and other terminal illnesses affecting children. ... to St. Jude Children,s Research Hospital. Guests will enjoy complimentary ... and savory Vietnamese restaurant in Falls Church for all guests. ...
(Date:12/5/2009)... Leukemia and myeloproliferative disorders are serious and ... the 51st Annual Meeting of the American Society ... improved diagnostic methods for patients suffering from acute ... leukemia, and myelofibrosis that are based on a ...
(Date:12/5/2009)... develop and test their cleaning processes. The technology available to the ... solve problems for customers relating to cleaning parts, process development, and ... ... Midbrook, Inc , a Jackson, MI-based company, is home to an ...
(Date:12/5/2009)... in the most unusual places, and to do everything from growing mushrooms, ... ... 2009 -- Who would have thought that your wine, water and vegetables ... has announced a new line of turbines, for industry end users, not ...
(Date:12/4/2009)... LLP employees came together in more than 90 offices nationwide ... the audit, tax and advisory firm,s support for literacy with ... firm,s long history of volunteerism. Instead of holiday parties, our ... holidays for some children," said Tim Flynn, Chairman of KPMG. ...
Breaking Medicine News(10 mins):Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 2Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 3Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 4Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 5Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 6Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 7Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 8Health News:Advances in Genetic Understanding and Treatment Protocols Lead to Significant Progress in Leukemia and Myeloproliferative Disorders 9Health News:Midbrook Lab Testing Provides Results for Cleaning Process Develop and Verification 2Health News:Midbrook Lab Testing Provides Results for Cleaning Process Develop and Verification 3Health News:Distributor Announces New Applications for Wind Turbines 2Health News:Distributor Announces New Applications for Wind Turbines 3Health News:KPMG Employees Provide 'Holiday Bear Hugs' and Books in Firmwide Service Day for Children 2
(Date:12/2/2009)... an increased risk of developing lung cancer in adulthood, even ... are published in Cancer Epidemiology, Biomarkers & Prevention , ... part of a special tobacco focus in the December issue. ... be diagnosed with lung cancer; more than 159,000 will die ...
(Date:12/2/2009)... that people who smoke cigarettes over a long period ... cancer, even after adjusting for other risk factors. ... or to quit as soon as possible," said senior ... epidemiology and surveillance research at the American Cancer Society. ...
(Date:12/2/2009)... smoke their first cigarette within minutes after waking up have ... processed by the body, than those who wait to smoke, ... , "Since cotinine levels appear to reflect the risk of ... after waking may be especially at risk for lung cancer," ...
Breaking Biology News(10 mins):Secondhand smoke exposure in childhood increases lung cancer risk later in life 2Cigarette smoking increases colorectal cancer risk 2Increased nicotine levels detected in those who light-up earlier 2Researchers effectively treat tumors with use of nanotubes 53492 1Researchers effectively treat tumors with use of nanotubes 53492 2Researchers effectively treat tumors with use of nanotubes 53492 3Why anorexic patients cling to their eating disorder 53489 1Why anorexic patients cling to their eating disorder 53489 2Scientists open doors to diagnosis of emphysema 9456 1Scientists open doors to diagnosis of emphysema 9456 2
Other Contentsosteoarthritisosteoarthritisosteoarthritisosteoarthritisosteomaosteomyelitisosteosarcomaexterna