Navigation LinksBiology NewsHealth NewsBiology TechnologyMedicine Technology

We're sorry, that page ( was not found.

Search nepalese at Google

Search nepalese at Yahoo

Search nepalese at Bing

(Date:3/20/2017)... HANOVER, Germany , March 20, 2017 At ... Hamburg -based biometrics manufacturer DERMALOG. The Chancellor came to the ... Japan is this year,s CeBIT partner country. At the largest ... important biometrics in use: fingerprint, face and iris recognition as well as ... ...
(Date:3/16/2017)... - Against identity fraud with DERMALOG solutions "Made in Germany "  ... ... multi-biometric solutions provide a crucial contribution against identity fraud. (PRNewsFoto/Dermalog Identification Systems) ... Used combined in one project, multi-biometric solutions provide a crucial contribution against identity ... ...
(Date:3/9/2017)... Australia , March 9, 2017 /PRNewswire/ ... at the prestigious World Lung Imaging Workshop at the ... Fouras , was invited to deliver the latest data ... This globally recognised event brings together leaders at the ... latest developments in lung imaging. "The ...
Breaking Biology News(10 mins):
(Date:3/27/2017)... ... 27, 2017 , ... Advantexe Learning Solutions , a ... a new research study, The Business Readiness Report. The report explores the correlation ... the actual success of achieving individual and company goals. , There are ...
(Date:3/27/2017)... ... 27, 2017 , ... Janet Schloz is still in shock after receiving a $2,500 Academic Award ... a long time,” she said. , She thinks the coming week is going to be ... I would have to help my students.” , The award will allow the 4th grade ...
(Date:3/27/2017)... Mt. Angel, Oregon (PRWEB) , ... March 27, ... ... supplements company, is pleased to announce the launch of a months-long rebranding effort. ... exciting new formulations. , “Through focus group discussions and market research, we learned ...
(Date:3/27/2017)... ... 27, 2017 , ... The homeowner improvement and repair market is expected to ... unlicensed contractors for renovations is also on the rise. Per a 2017 report, 13% ... those, 42% failed to use a licensed contractor.(2) The risks associated with improper renovations—especially ...
(Date:3/25/2017)... ... 25, 2017 , ... Norland at Swissray is pleased to announce the release of ... The ELITE DXA has an active scan window, which is more than double that of ... the scan area could not undergo an accurate total body bone density or body composition ...
Breaking Medicine News(10 mins):
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a full length recombinant PPIL2. NCBI Entrez Gene ID = PPIL2...
Mouse monoclonal antibody raised against a full length recombinant SCGB3A2. NCBI Entrez Gene ID = SCGB3A2...
Biology Products:
... Laboratories is a national reference laboratory and ... and development. ARUP offers an extensive test ... tests in clinical and anatomic pathology. Owned ... clients include more than half of the ...
... ARUP Laboratories is a national reference ... laboratory research and development. ARUP offers an ... unique medical tests in clinical and anatomic ... ARUP Laboratories' clients include more than half ...
... ARUP Laboratories is a national reference laboratory ... research and development. ARUP offers an extensive ... medical tests in clinical and anatomic pathology. ... Laboratories' clients include more than half of ...
... a national reference laboratory and a worldwide ... ARUP offers an extensive test menu of ... clinical and anatomic pathology. Owned by the ... more than half of the nation's university ...
Medicine Products:
(Date:3/24/2017)... Md. , March 24, 2017  Infectex Ltd., ... (MBVF), today announced positive results of a Phase 2b-3 ... therapy regimen in patients with multidrug-resistant pulmonary tuberculosis (MDR-TB). ... scientists at Sequella, Inc. ( USA ) ... A total of 140 patients were enrolled in ...
(Date:3/24/2017)... , March 24, 2017 Agenus Inc. ... immune checkpoint antibodies and cancer vaccines, today announced participation ... 7 th  Annual William Blair and Maidstone Life Sciences ... Alexandria Center in New York, NY ... March 29 at 9:40 am: Robert B. ...
(Date:3/23/2017)... March 23, 2017  SeraCare Life Sciences, ... in vitro diagnostics manufacturers and clinical laboratories, ... first multiplexed Inherited Cancer reference material ... by next-generation sequencing (NGS). The Seraseq™ Inherited Cancer ... input from industry experts to validate the ...
(Date:3/23/2017)... NEW YORK , March 23, 2017 ... ... causes of death, putting significant strain on health care systems, ... of cancer diagnoses rises, so too does the development of ... with minimum side effects. Among the many types of cancer ...
Breaking Biology Technology:
(Date:3/27/2017)... - INVICTUS MD STRATEGIES CORP. ("Invictus MD" or the "Company") ... pleased to announce it has received conditional approval to ... Venture Exchange.  Receiving the conditional listing ... achievements for Invictus-MD. Some of which include: ... Inc. ("AB Labs"), a Licensed Producer under the Access ...
(Date:3/27/2017)... 2017  BERG, a biopharmaceutical company uncovering ... approach, today announced that the company,s Interrogative ... new data using a cold-induced model to ... Joslin Diabetes Center led the investigation with ... analysis of samples.  The findings were published ...
(Date:3/27/2017)... , March 27, 2017  iCAD (Nasdaq: ICAD), ... solutions and radiation therapy for the early identification ... Tomo Detection received Premarket Approval (PMA) from the ... Detection is a first-of-its-kind, concurrent-read computer aided detection ... the latest innovation available on the PowerLook® Breast ...
Breaking Medicine Technology: