Navigation Links


Need in Medical News

Photo: New Survey Results Show Most Moms Are Aware Their Pre-teens and Teens Need Vaccines

NEW YORK, Aug. 7 /PRNewswire/ -- A new survey reports that most moms know their children need additional vaccines beyond those received when they were infants or small children. But according to Centers for Disease Control and Prevention (CDC) estimates, most pre-teens and teens do not h...

Food Allergy Facts Need More Focus

Many U.S. adults unaware there is no cure, survey finds THURSDAY, Aug. 6 (HealthDay News) -- More than two-thirds of U.S. adults mistakenly believe that daily medicine can be taken to prevent a food allergy reaction, according to a survey that found a widespread lack of knowledge and ...

Families With Special Needs Children Need Special Financial Strategies

ST. PAUL, Minn., Aug. 4 /PRNewswire/ -- More than 15 percent of Americans over the age of five have some sort of disability, according to the U.S. Census Bureau. Parents with special needs children know they need to create a long-term strategy to provide care for those children after the...

Patients Issue Summer Call to Action: 'We Need You to Donate Blood -- NOW'

NEW YORK, Aug. 3 /PRNewswire/ -- Three New York Blood Center (NYBC) patients are taking to the airwaves to recruit new blood donors, and encourage existing blood donors to donate blood NOW. Demand for blood has been very high this summer from the 200 hospitals served by NYBC and its regional...

Does the Crowded TNF Market Really Need Two New Agents? Rheumatologists Provide Insight in the Wave One Report of LaunchTrends(TM): SIMPONI and CIMZIA

EXTON, Pa., July 31 /PRNewswire/ -- BioTrends Research Group, Inc. announces the release of the wave one LaunchTrends (TM): SIMPONI and CIMZIA report. The survey was completed by U.S. Rheumatologists in late June 2009. While awareness of both new TNF antagonists is relatively h...

Determining Insulin Pump Need for Diabetics

WESTERVILLE, Ohio, July 28 /PRNewswire/ -- All doctors recommend diabetic patients control their glucose level, but how can they do this while preserving a normal lifestyle? By using an insulin pump and carbohydrate counting, a diabetic can maintain precise glycemic control and le...

More>>

Need in Medical Technology

New Safety Regulations Drive Greater Need for Resources and Expertise at Every Stage of Clinical Development

DUBLIN, June 18 /PRNewswire-FirstCall/ -- According to a report issued today, drug safety leaders in pharmaceutical and biotechnology companies recognise the need to increase resources, either internally or through partnerships, to comply with the safety regulations recently issued by the U.S....

Observational Study Finds Changes in Medicare Reimbursement for Erythropoiesis-Stimulating Agents Associated With Increased Need for Blood Transfusion

SAN FRANCISCO, Dec. 6 /PRNewswire/ -- Researchers today report that after the implementation of Medicare coverage limitations for erythropoiesis-stimulating agents (ESAs), a significantly greater proportion of anemic cancer patients who were on chemotherapy and who received ESAs needed blood trans...

Breast MRI Scan Could Determine Need for Radiation Therapy

SEATTLE, Sept. 21 /PRNewswire/ -- For women whose breast cancer has spread to their lymph nodes, a magnetic resonance imaging (MRI) scan could replace exploratory surgery as the method for determining whether those women need radiation therapy to treat their disease, according to a study to be...

RAD001 Granted Priority Review in the US Based on Potential to Fill Unmet Medical Need in Patients With Advanced Kidney Cancer

-- Regulatory applications to be submitted worldwide for RAD001 first submissions filed in the Hidden List US, EU and Switzerland -- Data showing that RAD001 more than doubles time without tumor growth and reduced risk of disease progression by 70% now published in The...

As Summer Heats Up, New Survey Reveals Need for Effective Sweat Treatments

- International Hyperhidrosis Society Offers Tips for Managing Summer Sweat - NEW YORK, June 18 /PRNewswire/ -- As the thermometer rises, so does the humidity. For many, the humidity can be annoying, but for the nearly 8 million Americans who suffer from a treat...

Animals That Cyclone Survivors Depend on Need Help Now

BANGKOK, Thailand, May 9 /PRNewswire-USNewswire/ -- An emergency veterinary team from the World Society for the Protection of Animals (WSPA) is on stand-by in Thailand awaiting authority to enter cyclone struck Myanmar to assess and then relieve the suffering of thousands of animals that human...
Need in Medical Products

3M™ Littmann® Electronic Stethoscope Model 3000

Description:... Don't miss the sounds you need to hear! Amplify heart, lung, and other body sounds while reducing distracting ambient noise with the Littmann Model 3000. With Ambient Noise Re...
Company:3M Worldwide

Para 12 Plus Retics 5-Part Differential Control

Description:...s that can be analyzed and enumerated by the CELL-DYN 4000. The assay contains automated and manual reticulocyte values for all three levels. The user need only purchase, inventory and manage quality control records for one control. This unique product has seven-day open-vial stability, 75-day closed-vial...
Company:Streck

VISULAS YAG III Combi Complete Laser Therapy System

Description:...i is the optimal system for photocoagulation, post-cataract treatments, laser trabeculoplasty, and combined iridotomy. The push of a button is all you need to switch between two laser systems....
Company:Carl Zeiss Meditec, Inc.

Afinion HbA1c test

Description:... The Afinion HbA1c test and the fully automated Afinion Analyzer, give you reliable facts conveniently available when and where you need them. Advising the patient can be carried out with confidence. The HbA1c Test Cartridge contains all reagents necessary for the measurement of glycate...
Company:Axis-Shield

Vivid e

Description:... The Vivid e delivers everything you need in a compact echo system, like complete cardiovascular functionality, a comprehensive cardiac measurement and analysis package, and full shared servic...
Company:GE Healthcare, CV Ultrasound

TPS-TL Spinal Spacer

Description:...nted telescoping plate design integrates the functions of an anterior plate and vertebral column spacer. This unique, integrated design eliminates the need for supplemental fixation while allowing a generous amount of bone graft to be delivered to the operative site....
Company:Biomet, Inc.

More>>

Need in Medical Definition

Acute care

...mbulatory care clinic, or other short term stay facility. An important aspect of the current health care crisis in the US is the result of the growing need for acute care despite a decrease in the number of facilities which provide that care. This mismatch has resulted from the dramatic increase in the nu...

Doctor-patient relationship

... This article (or section) may need to be wikified to meet 's quality standards . Please help improve this article , especially its section layout , and relevant internal link...

Episodic memory

...). The relationship of episodic memory to semantic memory Episodic memory is thought of as being a "one-shot" learning mechanism. You only need one exposure to an episode to remember it. Semantic memory , on the other hand, can take into consideration multiple exposures to each referent - the...

Fat transfer

...-Injected Fat Grafting A few plastic surgeons claim to offer better results when they remove strips of healthy fat and replant them into areas that need augmentation For instance, one Los Angeles, California, plastic surgeon, Brent Moelleken, M.D., F.A.C.S., is among practitioners who have trademarked...

Full-body scan

...or disease, the risks of full-body CT scans, (including radiation, incidental or wrong diagnosis, and a false sense of security in a test with error), need to be outweighed by the benefit of identifying a treatable disease at an early stage. [5] One of the risks of a full body CT scan is the relatively...

Ganglion cyst

...joint capsule, a common misconception. They occur most often in the 20–60 age group and are three times more common in females 1 . They are benign but need to be differentiated from more serious conditions. They contain clear fluid similar to synovial fluid (a clear, lubricating, viscous fluid found in ...
Need in Medical Dictionary

Mammogram

...e Nuts and Bolts of Reform Proposals ... Watch this video to learn about mammograms , exams for early detection of breast cancer. ... You don't need to prepare for a mammogram . ... ... can make a mammogram more difficult to ... Do they interfere with mammograms ? ... Video: Mammogram f...

Wind

... The wind blew through her hair as she stood on the deck ... second lap he was already out of wind . ... minute before we jog the next mile — I need a second wind . ... Questioning the faith of wind power, by David Roberson ... But many who support wind power are sadly unaware of the techn...

Whooping cough

...agnosis Treatment Prognosis Prevention Resources Whooping Cough Definition Whooping cough , also Pertussis ( Whooping Cough ) – What You need To Know. Brief description ... Parents: Protect Yourself and Your Children from Whooping Cough (Flyer) (exit) ... Characterized by severe coug...

Wheezing

...g tubes deep ... What is wheezing ? What does it sound like? What do I need to do about it? Learn what you need to know and to related to wheezing . Definitive treatment of wheezi...

Weight gain

...e mass, fat deposits, or excess fluids such as water. How to gain weight , totally FREE weight gain information including everything you need to ... Even though weight gain is your goal, you don't want to be ... Get weight gain tips about gaining weight at WeightGain.Lifetips.c...

Vulva

...; Conditions Database. Allergies Center. Brain Health ... genitals — those you can see — is the vulva , meaning "covering" ... Vulva . You don't need to be Editor-In-Chief to add or edit content to WikiDoc. ... Ongoing Trials on Vulva at Clinical Trials.gov. Trial results on Vulva ... ... ...
Need in Biological News

Report shows the power of US cities to mitigate climate change and steps they need to take to adapt

U.S. municipal governments are showing leadership by voluntarily accounting for and reducing greenhouse gas emissions resulting from their operations. They also recognize the huge potential to influence long-term reductions from the residents and businesses in their communities, according to a ne...

Women with endometriosis need special care during pregnancy to avoid risk of premature birth

Amsterdam, The Netherlands: The largest study to date of endometriosis in pregnant women has found that the condition is a major risk factor for premature birth, the 25th annual conference of the European Society of Human Reproduction and Embryology heard today (Wednesday July 1). Dr. Henrik Falco...

Infant formula adulteration with melamine underscores need for better detection methods

Rockville, Md., June 17, 2009 Following the recent adulteration of infant formula and other milk products with the industrial chemical melamine, the U. S. Pharmacopeial (USP) Convention is holding an international workshop this week to explore better ways to detect deliberately falsified protein ...

They are young and need the job: A second chance for dangerous T-cells

The immune system's T-cells react to foreign protein fragments and therefore are crucial to combating viruses and bacteria. Errant cells that attack the body's own material are in most cases driven to cell death. Some of these autoreactive T-cells, however, undergo a kind of reeducation to become ...

Broecker: 'What we need are tougher measures against climate change'

U.S. researcher Wallace S. Broecker (Chicago, 1931), winner of the first edition of the BBVA Foundation Frontiers of Knowledge Awards in the Climate Change category, published an article in Science back in 1975 with the title "Climate Change: Are We on the Brink of a Pronounced Global Warming?" ...

Drugs needed to preserve eggs for reproduction need to be given in stages

AUGUSTA, Ga. Cryoprotectants needed to preserve eggs for reproduction need to be given in stages, albeit rapid ones, say scientists who have developed a mathematical model that predicts optimal time for loading and unloading these drugs. Their studies in Rhesus monkey eggs, which are very simi...

More>>

Need in Biological Technology

Brain Monitor Eliminates Need for Routine Oxygen With Propofol - Friedberg's Triad Unveiled

Most healthy patients can safely breathe room air without supplemental oxygen when getting propofol sedation if they have brain monitoring, says Dr. Barry Friedberg, developer of PK anesthesia. The huge, 19-fold variation in propofol detox between patients is why most anesthesia providers routine...

Remuda Ranch Programs for Eating and Anxiety Disorders Reports Need for Increasing Awareness of Eating Disorders in Males

PHOENIX, July 2 /PRNewswire/ -- As many as five to ten million males in the U.S. struggle quietly with an eating disorder because they're ashamed to admit they have the illness, reports Remuda Ranch Programs for Eating and Anxiety Disorders . Healthcare professionals, family members and close...

Sanofi Pasteur Responds to Nation's Need for Hib Vaccine With Increased Supply

- The CDC Reinstates Booster Dose of Hib Vaccine - SWIFTWATER, Pa., June 25 /PRNewswire/ -- Sanofi Pasteur, the vaccines division of the sanofi-aventis Group (EURONEXT: SAN and NYSE: SNY ), announced today that the company has been able to increase the supply of its Hib-containing vaccines...

Does Synthetic Biology Need Synthesized Ethics?

New Report Calls for a Broad Ethics of Emerging Technologies WASHINGTON, June 24 /PRNewswire-USNewswire/ -- The emerging field of synthetic biology will allow researchers to create biological parts and systems that do not occur naturally as well as to re-engineer existing organisms to perform...

New England Journal of Medicine Study Highlights Need for Rapid, PCR-based Group B Streptococcus (GBS) Testing at Time of Admission for Labor and Delivery

SUNNYVALE, Calif., June 24 /PRNewswire-FirstCall/ -- Cepheid (Nasdaq: CPHD ) today noted that a new article, Evaluation of Universal Antenatal Screening for Group B Streptococcus, published in the June 2009 issue of the New England Journal of Medicine concluded that rapid, PCR-based testing at...

Study Finds Noninvasive Blood Test for Liver Fibrosis May Alleviate Need for Liver Biopsies for Some Patients with Chronic Hepatitis C

MADISON, N.J., June 8 /PRNewswire-FirstCall/ -- A study in the June issue of Clinical Gastroenterology and Hepatology , published by Elsevier, demonstrates that the Hepascore(TM) liver fibrosis blood-serum test panel may help physicians more accurately diagnose and stage liver fibrosis in patie...

More>>

Need in Biological Products

Easy Clean DNA Spin Filter from Primm Labs

Description:...igh melt agarose. Simply place your DNA gel slice in the spin filter, centrifuge for 3 minutes, and the majority of your DNA is recovered. There is no need to melt agarose or use any special buffers. Spin filters can also be used for buffer exchange, primer removal from PCR reactions, and removal of exce...
Company:Primm Labs

SelectFX Alexa Fluor 488 Cytochrome c Apoptosis Detection Kit - for fixed cells from Molecular Probes (Invitrogen)

Description:... The SelectFX Alexa Fluor 488 Cytochrome c Apoptosis Detection Kit provides all the reagents you need to detect cytochrome c in fixed cells. The kit employs an anti-cytochrome c primary antibody and an Alexa Fluor 488 dye-labeled secondary antibody. A...
Company:Molecular Probes (Invitrogen)

Zero Background/Kan Cloning Kit from Invitrogen

Description:...stance for selection in E. coli. The pZErO-2 vector utilizes positive selection to eliminate high background. The kit contains all of the reagents you need for simple cloning and analysis of your insert....
Company:Invitrogen

Express Cloning Checker Kit I from BioChain

Description:...tifying recombinant colonies after transformation without time-consuming plasmid preparation. By using the large-scale screen method in Kit I, all you need to do is to transfer partial colonies of E. coli bacteria directly from the transformation plates into the solutions provided by the kits and immediat...
Company:BioChain

Customized Competent E. coli. from Molecular Cloning Laboratories (MCLAB)

Description:... This service is for when you need to make your strain of cells competent or to increase their transformation efficiency. Our services for preparing competent cells are comprehensive an...
Company:Molecular Cloning Laboratories (MCLAB)

Micro-OSMETTE from Precision Systems, Inc.

Description:...eter for 50 L samples. Operating head automatically rises at the end of determination; triple-point calibration verification; refrigerator eliminates need for pumps and bath liquid; rapid cooldown; bench-saver design. * Range: 0-3000 mOsm/kg H2O ...
Company:Precision Systems, Inc.
Need in Biological Definition

Active transport

... concentration rises steeply or "spikes" and enables rapid recovery. This shows that a single type of ion can be transported by several enzymes, which need not be active all the time (constitutively), but may exist to meet specific, intermittent needs. Co-transport Co-transport also uses the flow o...

Albumin

...ler animals (for example rats ) function at a lower blood pressure , they need less oncotic pressure to balance this, and thus need less albumin to maintain proper fluid distribution. Functions of albumin:...

Allostery

...nge in one induces a similar change in the others. Thus all enzyme subunits need not exist in the same conformation. Moreover, the sequential model dictates... binding sites are more receptive to substrate. To summarize: subunits need not exist in the same conformation molecules of substrate bind via induc...

Allostery

...nge in one induces a similar change in the others. Thus all enzyme subunits need not exist in the same conformation. Moreover, the sequential model dictates... binding sites are more receptive to substrate. To summarize: subunits need not exist in the same conformation molecules of substrate bind via induc...

Antibiotic

... During the same era, Rene Dubos isolated tyrothricin , an antibiotic used topically for skin infections, from soil bacteria. With the increased need for treating wound infections in World War II , resources were poured into investigating and purifying penicillin, and a team led by Howard Walter F...

Reproduction

... can spend time nurturing and protecting them, hence greatly decreasing the need to reproduce; on the other hand, animals with many offspring do not need to spend parental energy on nurturing, allowing more energy to be devoted t...
Need in Biological Dictionary

Zona pellucida

...yte, surrounding follicle ... Development of the zona pellucida in the rat oocyte. Am J Anat. 1974 Apr;139(4) ... Zona pellucida . You don't need to be Editor-In-Chief to add or edit content to WikiDoc. ... The zona pellucida is seen as a thick clear girdle surrounded by ... tered in disc...

Z-DNA

...this with Z-DNA , which behaves much differently. ... Fratini & M. L. Kopka (1982) The anatomy of A-, B-, and Z-DNA . ... This explains the need for alternating purines and pyrimidines to form Z-DNA . ... R. M. Wing, A. V. Fratini & M. L. Kopka (1982) The anatomy of A-, B-, and Z-DNA . ...

Wolffian duct

...sis and reviews from Psychology Journals, Newspapers, and magazines at HighBeam.com. Free Trial, Credit Card Required. Wolffian duct . You don't need to be Editor-In-Chief to add or edit content to WikiDoc. ... Wolffian duct . Urogenital sinus of female human embryo of eight and ... The Pr...

Western blotting

...lotting tells you how much protein has accumulated in cells. ... a protein is degraded quickly, Western blotting won't detect it well; you'll need to ... Pall Corporation manufactures Western blotting membranes made from ... Part 1 - Western Blotting Membranes Binding Interaction, Me...

Western blot

...lotting tells you how much protein has accumulated in cells. ... a protein is degraded quickly, Western blotting won't detect it well; you'll need to ... Pall Corporation manufactures Western blotting membranes made from ... Part 1 - Western Blotting Membranes Binding Interaction, Me...

Vitamins

...oard with vitamins . ... Get the facts on vitamins and calcium supplements. ... Water-soluble vitamins dissolve in water. ... These vitamins need dietary fat in order to be absorbed in ... ...
Other TagsheldheldexpensiveharmharmharmharmharmharmTwinTwinTwinrecordsrecordsrecords
(Date:11/20/2009)...e-FirstCall/ - NUCRYST Pharmaceuticals Corp. annou...will be held on Monday, December 21, 2009. The pur... special resolutions. The first special resolution...bstantially all of the assets of NUCRYST, substant...ase agreement dated November 10, 2009 among the NU...
(Date:11/20/2009)...ssmen in Competitive Re-election Battles Could Be ... Washington, DC (Vocus) November 20...election next year in races deemed to be competiti...ret voting for House Speaker Nancy Pelosi’s ...ternational/ O’Leary Report poll. (The Pol...
(Date:11/20/2009)... Cardio Vascular,Medical ...M , a leading,developer of advanced cardiovascular...any,s Board of Directors has decided to initiate p...ast for its proprietary next-generation,"steerable...procedures. , Cardio Vascular Medical Dev...
(Date:11/20/2009)...n the Journal of the National Cancer Institute d...n appear in news coverage of cancer research. The ... journals to help alleviate the problem. , Lisa ..., M.S., of Center for Medicine and the Media at th...al Practice in New Hampshire, and Barnett S. Krame...
(Date:11/20/2009)..., TX, the new addition to blue sky scrubs will ens... USA. , Austin, TX (PRWEB...endent medical scrubs brand which focuses primaril...ion of hospital uniforms and surgical scrub hats. ...nline boutique, the Austin, TX business has grown ...
Breaking Medicine News(10 mins):Health News:NUCRYST Announces Special Meeting of Shareholders 2Health News:NUCRYST Announces Special Meeting of Shareholders 3Health News:Just 25% of Voters in Competitive 2010 Senate Races “Much More Likely” to Support Pelosi-Democrats Who Voted for Health Care Bill 2Health News:Just 25% of Voters in Competitive 2010 Senate Races “Much More Likely” to Support Pelosi-Democrats Who Voted for Health Care Bill 3Health News:Cardio Vascular Medical Device to Apply for Additional Patents in Europe, Canada and Far East 2Health News:Promoting healthy skepticism in the news: Helping journalists get it right 2Health News:Blue Sky Scrubs Secures a Second Texas Manufacturer 2
(Date:11/20/2009)...ess an ingenious mechanism for preventing oxygen f...is the new finding of a team of biologists that in...rch institute in Flanders, Belgium, connected to t... this discovery by modifying the DNA of the intest...s model organism, they have uncovered the existenc...
(Date:11/20/2009)...), a respiratory disease commonly known as chronic...use of death worldwide. 600 million people live w...y real treatment or cure, Grace Parraga of Robarts...ntario in London, Canada, is using various imaging... , Parraga is a scientist in the Imaging Rese...
(Date:11/19/2009)...ith an unwieldy name: 4-hydroxybutyrate (4-HB). Ta...ape drug. , Now, a team of Ohio and Michigan sc...is metabolized by the body. "This is new and impor...or and chair of biological sciences at Michigan Te...h team. "It may provide new clues on how to count...
Breaking Biology News(10 mins):Biologists discover bacterial defense mechanism against aggressive oxygen 2Gaining a better picture of lung disease 2Researchers begin to decipher metabolism of sexual assault drug 2Tumor suppressor gene in flies may provide insights for human brain tumors 8948 1Tumor suppressor gene in flies may provide insights for human brain tumors 8948 2Hospital Bedside Technology Solution Results in 74 Percent Reduction in Heart Failure Readmission Rate 49621 1Hospital Bedside Technology Solution Results in 74 Percent Reduction in Heart Failure Readmission Rate 49621 2Hospital Bedside Technology Solution Results in 74 Percent Reduction in Heart Failure Readmission Rate 49621 3Dismantling Roe v Wade Would Affect All Pregnant Women 49618 1Dismantling Roe v Wade Would Affect All Pregnant Women 49618 2Dismantling Roe v Wade Would Affect All Pregnant Women 49618 3
Other Contentschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatory