Navigation Links


Meditation in Medical News

Pilot study: Workplace yoga and meditation can lower feelings of stress

COLUMBUS, Ohio Twenty minutes per day of guided workplace meditation and yoga combined with six weekly group sessions can lower feelings of stress by more than 10 percent and improve sleep quality in sedentary office employees, a pilot study suggests. The study offered participants a modified ...

Transcendental Meditation buffers students against college stress: Study

Research at American University shows meditating students react better to stress, are less fatigued, have more 'integrated' brains Transcendental Meditation may be an effective non-medicinal tool for students to buffer themselves against the intense stresses of college life, according to a...

Study finds Zen meditation alleviates pain

This release is available in French . Montreal, February 3, 2009 Zen meditation a centuries-old practice that can provide mental, physical and emotional balance may reduce pain according to Universit de Montral researchers. A new study in the January edition of Psychosomatic Medicine...

Dr. Ajrawat's Air-Pulse Autonomic Meditation Therapy, a Revolutionary, Scientific, Meditation Therapy, Receives Patent Trademark

Dr. Ajrawat's Air-Pulse Autonomic Meditation Therapy is a non-denominational therapy that allows individuals to balance body and mind without the loss of identity many feel when adopting ancient mind controlling meditative healings. Potomac, MD (PRWEB) August 14, 2008 &...

The Chopra Center Co-founders Will Teach a Beginning Course in Meditation and Mind-body Healing This August in Chicago

Deepak Chopra, M.D. and David Simon, M.D. created the Renewal Weekend workshop to share the practical tools of natural health, stress relief, and peace of mind CHICAGO, June 26 /PRNewswire/ -- If you have wanted to explore meditation, yoga, and the Eastern healing ...

Transcendental meditation effective in reducing high blood pressure, study shows

LEXINGTON, Ky. (Dec. 4, 2007) − People with high blood pressure may find relief from Transcendental Meditation, according to a definitive new meta-analysis of 107 published studies on stress reduction programs and high blood pressure, which will be published in the December issue of Current ...

Body-mind meditation boosts performance, reduces stress

A team of researchers from China and the University of Oregon have developed an approach for neuroscientists to study how meditation might provide improvements in a person's attention and response to stress. The study, done in China, randomly assigned college undergraduate students to 40-perso...

Of body and mind, and deep meditation

Chinese researchers have unlocked the mechanism of an emerging mind-body technique that produces measurable changes in attention and stress reduction in just five days of practice. The practice -- integrative body-mind training (IBMT) -- was adapted from traditional Chinese medicine in the 1990...

A Mindful Chocolate Meditation

OAKLAND, Calif., Oct. 16 /PRNewswire/ -- Walk into any grocery store and there's likely to be a Halloween aisle brimming over with candy. Those who struggle with mindless eating have already begun to wonder how they'll stay clear of trick-or-treat sweets. Many people find that Halloween spurs ...

Transcendental Meditation Can Help

In this high-tech age of modern medicine, could it be possible to treat the leading cause of death in the U.S. through the power //of meditation? According to a study, a widely practiced, stress-reducing meditation technique can significantly reduce the severity of congestive heart failure. ...

More>>

Meditation in Medical Technology

Award-Winning Medicine Wheel Returns to the Cyclorama at the Boston Center for the Arts on Dec. 1 for 24-hour Vigil Recognizing World AIDS Day

...rama. The 24-hour vigil blends the grace of public art with the gravity of the public health message regarding youth and HIV/AIDS. "Each bucket is a meditation -- on the vulnerability of our youth, on the frailty of humanity, but also on our ability to respond with hope and awareness." said Michael Dowling, A...
Meditation in Medical Dictionary

Vitreous humor

...is website uses valid xHTML / CSS © Vitreous Humor . RSS 2.0. ATOM feed. Login ... Vitreous Humor -PhotoBlog: Buddha Is a Man, Photo Friday: meditation ... This website uses valid xHTML / CSS © Vitreous Humor . RSS 2.0. ATOM feed. Login ... Shop for Vitreous Humor and Music at Shop.com. Rel...

Palliative

...lay, or reverse progression of the disease itself or provide a cure. The goal is to prevent and relieve suffering and... Hospice Care Key Terms: meditation , Palliative care , Respite care , T'ai chi. ... Hospice care is palliative care given to individuals who are terminally ill with ... palliat...

Palliative Care

...y related hospice care . ... Palliative Care Referrals After Lung Transplantation in Major Transplant Centers ... Hospice Care Key Terms: meditation , Palliative care , Respite care , T'ai chi. ... Hospice services provide palliative care to individuals with a life expectancy ... Asso...

Daily life

...e : © 2007 All Rights Reserved. Using WordPress Engine ... ... learning meditation courses, as well as classes in Buddhism and practice in daily life . ... Mindfulness in daily life . Stress and meditation. meditation and ... Tibetan Yogic Training-progressive program of meditaition and r...
Meditation in Biological News

Putting feelings into words produces therapeutic effects in the brain

...lets it go.” “One way to practice mindfulness meditation and pay attention to present-moment experiences is...te student of psychology at UCLA, said mindfulness meditation is a “potent and powerful therapy that has been he... Previous studies have shown that mindfulness meditation is effective in reducing a variety of chronic pain...

Meditation associated with structural changes in brain

... The regular practice of meditation appears to produce structural changes in areas of ...ts who were experienced practitioners of a type of meditation commonly practiced in the U.S. and other Western c...ng in Washington, DC. "Our results suggest that meditation can produce experience-based structural alteration...

Dalai Lama, top scientists to discuss science & clinical applications of meditation

...edia coverage and was included in a cover story on meditation in TIME Magazine.The Mind & Life conference of...are opportunity to learn about the intersection of meditation and medicine. The conference, which will be held i...cal substrates of meditation, clinical research on meditation and mental Health, and clinical research on...

Drawing with DNA: 'Bioart' illuminates genomics

...ologists, artists and computer scientists from UCSD, UCLA and the University of Southern California. Named after Friedrich Nietzsche's Ecce Homo, a meditation on how one becomes what one is, the project explores human evolution by examining similarities ?a.k.a. "homology" ?between genes from human beings and...
Other TagsHandleHandleMultivitamins
(Date:11/24/2009)..., NEWYORK,Nov.24/PRNewswire-USNewswire/--Ther...oblems.Itisharmreduction,offeringpragmaticandreali...roblemshavefailed.Spearheadingthismovementisagroup...rationSupport.HAMSisafree-of-charge,lay-ledsupport..., TheNationalInstituteonAlcoholAbuseandAlcoholism...
(Date:11/24/2009)..., NEWYORK,Nov.24/PRNewswire/--TheGuardianLife...tmutuallifeinsurersandaleadingproviderofemployeebe...thatthecompanywillcontinuetofollowitscurrentinsura...eguidelinesareconsistentwiththeAmericanCancerSocie...sformammographyscreenings. ,, Recently,TheU.S.P...
(Date:11/24/2009)..., ChangesMustBeMadetoUSPSTFRepresentationand...ewswire-USNewswire/-- SeveralsectionsofSenatehealt...hatinsuranceentitiessuchasprivateinsurers,Medicare...vingaspecificgradefromtheU.S.PreventativeServicesT...icesforwomen40-49,wouldonlyrequirecoverageofbienni...
(Date:11/24/2009)... BEER-SHEVA, ISRAEL November 24, 2009 Researchers...ing a new device that detects cancerous skin tumor...naked eye. , During initial testing, the OSPI in...vealed new textures of lesions that have never bee... were diagnosed with various skin lesions and were...
(Date:11/24/2009)... INDIANAPOLIS Involving family members of pediatr...s benefits both the family and the medical team, a...icine study. , Riley Hospital for Children, whe...mall number of hospitals nationwide routinely offe...y patients the opportunity to join their child,s m...
Breaking Medicine News(10 mins):Health News:Harm Reduction for Alcohol: An Idea Whose Time Has Arrived 2Health News:USPSTF Mammography Recommendations Should Be Specifically Excluded From Health Care Reform Legislation 2Health News:USPSTF Mammography Recommendations Should Be Specifically Excluded From Health Care Reform Legislation 3Health News:New device enables early detection of cancerous skin tumors -- Ben Gurion U. 2Health News:Involving family in medical rounds benefits both family and medical team 2Health News:Involving family in medical rounds benefits both family and medical team 3Health News:Involving family in medical rounds benefits both family and medical team 4
(Date:11/24/2009)... protein that may help gut bacteria bind to the ga... probiotic producers to identify strains that are ...tics need to interact with cells lining the gut to...urfaces in the gut they are more likely to stick a...r Nathalie Juge from the Institute of Food Researc...
(Date:11/24/2009)...mber 24, 2009) -- The Wildlife Conservation Societ...e last remaining population of Siberian tigers has...ide of poaching and habitat loss. , ...ials of what needs to be done to protect remaining... The report was released by the Siberian Ti...
(Date:11/24/2009)... Spanish . , The presence of increased body ...ubstances in the blood, hinders the loss and maint...ect of the University of Navarra conducted by Estb... Pharmacy. , The project, entitled "A nutrigenet...ol of body weight and inflammation," examines how ...
Breaking Biology News(10 mins):A sticky solution for identifying effective probiotics 2Report shows dramatic decline in Siberian tigers 2It can be predicted the reaction obese patients will have to a diet 2Shrinking Bylot Island glaciers tell story of climate change 9745 1Shrinking Bylot Island glaciers tell story of climate change 9745 2Shrinking Bylot Island glaciers tell story of climate change 9745 3Shrinking Bylot Island glaciers tell story of climate change 9745 4Kaiser Workers Statewide Campaign Starts Tuesday 55751 1Kaiser Workers Statewide Campaign Starts Tuesday 55751 2This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 1This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 2This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 3This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 4
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria