Navigation Links


Juice in Medical News

Beetroot Juice May Boost Stamina

Study findings could apply to athletes, elderly, researchers say FRIDAY, Aug. 7 (HealthDay News) -- Beetroot juice can boost physical stamina and increase exercise endurance by up to 16 percent, a new British study shows. The researchers found that nitrate in beetroot juice reduces...

Old Orchard Brands Introduces Low-Sugar Acai Juice Blend

SPARTA, Mich., July 28 /PRNewswire/ -- The acai berry (pronounced ah-sigh-EE) has become America's new super fruit of choice due to its high nutritional value and relative affordability. However, traditional varieties of acai juice can contain a large amount of natural sugar, unwa...

BluePrintCleanse to Create a Juice Rush With Free Shipping to State of California

NEW YORK, July 21 /PRNewswire/ -- BluePrintCleanse (BPC), the popular nutritional juice cleanse Food & Wine Magazine recently dubbed "the cleanse for foodies," responded to a groundswell of requests from the Golden State by announcing today that it will offer fr...

BluePrintCleanse to Create a Juice Rush With Free Shipping to State of California

NEW YORK, July 21 /PRNewswire/ -- BluePrintCleanse (BPC), the popular nutritional juice cleanse Food & Wine Magazine recently dubbed "the cleanse for foodies," responded to a groundswell of requests from the Golden State by announcing today that it will offer fr...

US Farms, Inc. Launches Aloe Vera Juice Web Site for Hispanic Market

SAN DIEGO, June 16 /PRNewswire-FirstCall/ -- US Farms, Inc. (Pink Sheets: USFM ), announces the launch of its new Hispanic focused web site www.jugodealoevera.com , which will operate as a division of US Farms Inc. US Farms Aloe Vera Juice retails for $14.95 per bottle or wholesales for $8...

Is Cherry Juice a New 'Sports Drink?'

New Research Suggests Natural Anti-Inflammatory Power of Tart Cherries May Help Relieve Post-Exercise Muscle Pain SEATTLE, May 28 /PRNewswire/ -- Drinking cherry juice could help ease the pain for people who run, according to new research from Oregon Health & Science University presented...

Grapefruit Juice Boosts Anti-Cancer Drug's Effects

Small study finds 8-ounce glass enhances absorption of rapamycin 3 to 4 times MONDAY, April 20 (HealthDay News) -- Grapefruit juice boosts the anti-cancer effects of the drug rapamycin, according to a small study that included 25 patients with advanced solid tumors, for which there is...

Grapefruit juice boosts drug's anti-cancer effects

In a small, early clinical trial, researchers at the University of Chicago Medical Center have found that combining eight ounces of grapefruit juice with the drug rapamycin can increase drug levels, allowing lower doses of the drug to be given. They also showed that the combination can be effectiv...

US Farms, Inc. Launches Aloe Vera Juice Web Site

SAN DIEGO, April 9 /PRNewswire-FirstCall/ -- US Farms, Inc. (OTC Bulletin Board: USFM), announces the launch of its new web site www.usfarmsaloeverajuice.com , which will operate as a division of US Farms, Inc. US Farms Aloe Vera Juice retails for $14.95 per bottle or wholesales for $89.95 per ...

PlumSmart Plum Juice Clinically Proven to Help Regulate Digestion, Naturally

Sunsweet's PlumSmart Proven As Effective As the Leading Fiber Supplement YUBA CITY, Calif., April 9 /PRNewswire/ -- For people suffering from an irregular digestive tract who need trusted relief, there is now a clinically proven, natural solution that tastes better than chalky fiber supplemen...

More>>

Juice in Medical Technology

Men Treated for Localized Prostate Cancer Could Benefit From Pomegranate Juice Consumption

LINTHICUM, Md., April 27 /PRNewswire-USNewswire/ -- Pomegranate juice may slow the progression of post-treatment prostate cancer recurrence, according to new long-term research results being presented at the 104th Annual Scientific Meeting of the American Urological Association (AUA). Researcher...

Concord Grape Juice Has No Significant Impact on Body Weight

Recent study revealed that drinking polyphenol-rich 100% Concord grape juice was not associated with changes in appetite, energy intake or body weight CONCORD, Mass., Oct. 6 /PRNewswire/ -- Regular consumption of 100% polyphenol-rich Concord grape juice did not cause significant weight gain,...

Research Shows Decas Sweetened Dried Cranberries Pack Twice the Proanthocyanidin Punch as Cranberry Juice Cocktail

Decas SDCs Offer Greater Amounts of the Natural Compound Responsible for Antioxidant and Anti-adhesion Benefits CARVER, Mass., Dec. 13 /PRNewswire/ -- Decas Cranberry Products, Inc. announced today the results of new research showing that 1 oz. (or a 1/4 cup) of Decas Sweetened...

New Study Shows Concord Grape Juice has a Heart-Healthy Effect not yet Reported With Red Wine

CONCORD, Mass., Oct. 2 /PRNewswire/ -- Many studies have suggested that moderate red wine consumption is beneficial to cardiovascular health. But what if you'd like to skip the alcohol? Take heart: laboratory research, just presented at the WINEHEALTH 2007 conference in Bordeaux, France, showe...

Video: Data on More Than 15 Novartis Oncology Compounds at ASCO Highlight Progress Toward Targeted Therapies for Diverse Tumor Types

... Gleevec tablets should be taken with food and a large glass of water to minimize GI irritation. Gleevec tablets should not be taken with grapefruit juice and other foods known to inhibit CYP3A4. Patients should be informed to take Gleevec exactly as prescribed, not to change their dose or stop taki...

Video: Tasigna(R) Demonstrates Rapid Response as Initial Therapy in Life-Threatening Form of Leukemia

... Gleevec tablets should be taken with food and a large glass of water to minimize GI irritation. Gleevec tablets should not be taken with grapefruit juice and other foods known to inhibit CYP3A4. Patients should be informed to take Gleevec exactly as prescribed, not to change their dose or stop ...

More Than 200 Abstracts at ASH and SABCS Reveal Potential Compelling Patient Benefits From Novartis Oncology Current and Pipeline Therapies

... Gleevec tablets should be taken with food and a large glass of water to minimize GI irritation. Gleevec tablets should not be taken with grapefruit juice and other foods known to inhibit CYP3A4. Patients should be informed to take Gleevec exactly as prescribed, not to change their dose or stop ...

CherryPharm First All-Natural Food to Improve Sleep

...ity of Rochester Medical Center study reports this juice has beneficial effects on older adults ...erryPharm -- a proprietary all-natural tart cherry juice blend based on the proven health benefits of cherr... President & Founder, John Davey. "Our all-natural juice is helping people lead healthier lifestyles." St...

New Data Show TORISEL Improves Progression-Free Survival for Patients With Relapsed/Refractory Mantle Cell Lymphoma

...ternatives cannot be used, dose modifications of TORISEL are recommended. St. John's Wort may decrease TORISEL plasma concentrations, and grapefruit juice may increase plasma concentrations of the major metabolite of TORISEL, and therefore both should be avoided. The combination of TORISEL and sunitini...

New Analyses Presented at ASCO Reaffirmed Efficacy and Safety of TORISEL in Patients With Advanced Kidney Cancer

...ternatives cannot be used, dose modifications of TORISEL are recommended. St. John's Wort may decrease TORISEL plasma concentrations, and grapefruit juice may increase plasma concentrations of the major metabolite of TORISEL, and therefore both should be avoided. The combination of TORISEL and sunitini...
Juice in Medical Definition

Allopathic medicine

...n substances and foods for their effect on scurvy and discovered that lemon juice was specifically active; he clearly did not select lemon juice because it caused symptoms in the healthy man, either similar or opposite t...
Juice in Medical Dictionary

Stomach

.... The inside of the stomach is bathed in about half a gallon of gastric juice every day. ... Stomach - Definition of Stomach at Dictionary.com a ...omach is a sack-like organ that holds food and mixes it with gastric juice ... Cancer can start in any part of the stomach . ... Infection with t...

Pimples

...when excess sebum is produced and the ... ... glowing skin, black spots and pimples ... mint leaves and oats will reduce pimples . ... take the juice and apply it on the face daily to reduce pimples ... If the inflammation is deep in your skin, the pimples may enlarge to form firm, painful...

Pepsin

... " ... pepsin also pepsine n. A digestive enzyme found in gastric juice that catalyzes the breakdown of ... Pepsin is prepared commercially from ...edia article on pepsin (biochemistry), the powerful enzyme in gastric juice that digests proteins such as those in meat, eggs, seeds, or ... Defini...

Gastroesophageal reflux disease

...y gastric acid flowing from the stomach into the esophagus. Gastroesophageal reflux disease (GERD) occurs when the amount of gastric juice ... The prevalence of gastroesophageal reflux disease (GERD) increases in people ... ...

Gastrointestinal

...tinal tract consists of the mouth, ... Gastrointestinal Cancers Key Terms: Abdomen , Bile , Bile ducts , Digestion , Digestive system , Gastric juice , Gland , Lymph nodes , Lymphatic The many causes of gastrointestinal (GI) bleeding are classified into upper or ... Gastrointestinal Bleedi...

Fasting

...he free online English dictionary and encyclopedia. ... Fasting and abstinence in the Roman Catholic Church ... Links to the best web pages on juice and water fasting for healing disease or spiritual renewal ... Fasting Nutrition Addiction Recipes Spiritual Shopping Meet ... A powerful te...

Blackheads

...ps mostly consists of keratin and modified sebum,... With luck, the black heads would stick to the cotton wool and come off ... Applying lemon juice on the face will also help remove black heads from the face. ... Blackheads and whiteheads are a specific type of acne called comedones. ......

Belching

...doesn't pass through belching or flatulence, it can build ... Belching (eructation) is triggered in two ways. ... Even apple, grape, and prune juice can lead to belching . ... Belching may be associated with the use of ... Up-to-the-minute news coverage of national, regional and internatio...

Amylase

...ts carbohydrates (polysaccharides) into smaller disaccharide units, ... Although found in many tissues, amylase is most prominent in pancreatic juice and ... In contrast, 50% of amylase activity remained after 150 minutes of exposure to ... An amylase test measures the amount of this enzyme...
Juice in Biological News

Is cherry juice a new 'sports drink?'

SEATTLE, Wash., May 28, 2009, Drinking cherry juice could help ease the pain for people who run, according to new research from Oregon Health & Science University presented at the American College of Sports Medicine Conference in Seattle, Wash. The study showed people who drank tart cherry juice...

Drinking 100 percent fruit juice is associated with lower risk of obesity and metabolic syndrome

New Orleans (April 22, 2009) If you enjoy a glass of 100% juice as part of your daily routine, chances are you also have fewer risk factors for several chronic diseases when compared to your non juice-drinking peers. New research presented today at the Experimental Biology (EB) 2009 meeting highl...

Research suggests vegetable juice may help people with metabolic syndrome lose weight

NEW ORLEANS, April 19, 2009 Drinking at least one glass of low sodium vegetable juice daily may help overweight people with metabolic syndrome achieve better weight loss results. A study, conducted at the Baylor College of Medicine and presented at this week's Experimental Biology Meeting, found...

New study provides further evidence that apple juice can delay onset of Alzheimer's disease

Amsterdam, The Netherlands, January 22, 2009 A growing body of evidence demonstrates that we can take steps to delay age-related cognitive decline, including in some cases that which accompanies Alzheimer's disease, according to a study published in the January 2009 issue of the Journal of Alzhe...

New research: Fruit juice consumption not related to overweight in children

Los Angeles, London, New Delhi, and Singapore (April 14, 2008) -- Despite studies that assert otherwise, 100% fruit juice consumption is not related to overweight in children, according to the authors of A Review of the Relationship Between 100% Fruit Juice Consumption and Weight in Children and A...

New study shows Concord grape juice has a heart-healthy effect not yet reported with red wine

Many studies have suggested that moderate red wine consumption is beneficial to cardiovascular health. But what if youd like to skip the alcohol? Take heart: laboratory research, just presented at the WINEHEALTH 2007 conference in Bordeaux, France, showed that Concord grape juice stimulated an ar...

Microbial fuel cells turn on the juice

The combination of beer, wastewater, microbes, fuel cells, high school students and teachers sounds like a witches brew for an old fashioned, illicit 60s beach party. Instead, these are the components that comprise the heart and soul of a new high school science curriculum being developed...

Orange, grapefruit juice for breakfast builds bones in rats

It may sound like Saturday cartoons: a strong-boned rat that can't be broken. But a couple of Texas researchers say the real hero is citrus juice. Orange and grapefruit juice regularly given to lab rats prevented osteoporosis, long considered an unavoidable aging disease in which bones become mor...

Study identifies substances in grapefruit juice that interact dangerously with some drugs

New research from the University of North Carolina at Chapel Hill has identified and established the substance in grapefruit juice that causes potentially dangerous interactions with certain medications. For almost a decade, people have been told by their doctors and pharmacists to avoid grapefru...

Despite acidity, orange juice could still be a source of foodborne disease

Orange juice and other foods traditionally not associated with foodborne disease outbreaks can still be a source of disease, although rare. Public health officials should be aware of this possibility and on guard, say scientists presenting today at the 106th General Meeting of the American Society...

More>>

Juice in Biological Technology

Brown chemists create more efficient palladium fuel cell catalysts

... PROVIDENCE, R.I. [Brown University] Even small devices need power, and much of that juice comes from fuel cells. As these devices become even smaller, the rush is on to find more efficient ways to power them. In the last several years, s...

GRAS Status Opens Door to U.S. Food Industry

...Safe (GRAS). This comes as a result of the panel critically evaluating data and information pertinent to the use of Phospha E(R) in breakfast cereals, juice beverages and table fats. Phospha E(R) is a patented derivative of vitamin E with superior qualities, such as greater absorption and activity. In pr...

NanoLogix's Hydrogen-From-Waste Technology at Welch's Foods Featured on Environmental Radio Program

...n-from-waste extraction technology currently under development at a Welch's juice plant in Pennsylvania has been the focus of a broadcast article by "The All...ml and is titled as both "Microbes Turn Waste to Power" and "Welch's Grape juice Converted into Electricity". About NanoLogix, Inc. NanoLogix is a leadi...

Martek Announces Fourth Quarter and FY 2007 Financial Results

...ter co-branded with the Martek life'sDHA(TM) logo include: Food and Beverage Products -- Minute Maid(R) Pomegranate Blueberry Flavored 100% fruit juice blend with life'sDHA(TM) -- Beech-Nut(R) DHA Plus with life'sDHA(TM) baby food and cereals -- British Biologicals' Kids-Pro Nutrition Drink with...

Video and Photo: EMD Serono Launches easypod(R), New Electronic Growth Hormone Injection Device

...ormone delivery deficiency devices, easypod(R) was designed with patients in mind. easypod(R) has a sleek, ergonomic shape and is similar in size to a juice box. The device also features a hidden needle intended to help reduce patient anxiety. easypod(R) was the recipient of a 2007 Gold Medal from the Me...

FDA Approves New SPRYCEL(R) (Dasatinib) Product Labeling for Patients with Chronic-Phase CML

... inhibitor cannot be avoided, close monitoring for toxicity and a SPRYCEL dose reduction or temporary discontinuation should be considered. Grapefruit juice may also increase plasma concentrations of dasatinib and should be avoided. Drugs that may decrease dasatinib concentrations are: Strong CYP3A4 induce...

China-Biotics, Inc. Signs Intention Agreement to Supply Probiotics to Bright Dairy & Food Co., Ltd.

...iques. The products portfolio includes sterilized milk, pasteurized milk, acidophilus milk, UHT pasteurized milk, milk powder, butter cheese and fruit juice beverage. Bright Dairy distributes its products throughout China. As of Dec. 31, 2006, Bright Dairy had 2,262 full-time employees. The revenue was $ 9...

IT is critical for economic growth, says UW business dean

...s, Knetter noted. Of the three, IT's capacity to drive organizational change is the one that really matters going forward. "That's really where the juice is, and will continue to be for a long time," he said. And while much of the private sector already has reaped huge benefits from the IT revolution...

SLE of Eau Claire lands $2.2 million in federal contracts

...emaining charge in a battery, has become apparent because soldiers using electronic devices routinely swap out batteries without knowing the amount of juice remaining in them. Without knowing how long those batteries have left to live, Army units buy, stock, carry and dispose of more batteries than necessa...

Detection of Mutant K-ras in a Kindred With Hereditary Pancreatic Cancer by DGGE

... of the K-ras gene was examined for the presence of k-ras mutations by DGGE. Constitutional and pancreatic tissues or pancreatic juice in eight of the family members were evaluated. All samples that were positive by DGGE (Figure 2) were confirmed by DNA sequencin...
Juice in Biological Definition

Fermentation

...ulates. The "bright beer" is then ready for serving or packaging. Uses The primary benefit of fermentation is the conversion, e.g. converting juice into wine , grains into beer , and carbohydrates into carbon dioxide to leaven bread . According to Steinkraus (1995), traditionally food ...
Juice in Biological Dictionary

Food pyramid

...ance feature automatically calculates your energy ... The Diabetes Food Pyramid is another meal planning option that some people use. ... Fruit juice is ½ cup in the Diabetes Food Pyramid and ¾ cup in the USDA pyramid . ... U.S. Food PyramidWebMD Health ToolThis pyramid chart shows you w...

Fermentation

... in wine is the catalyst function that turns grape juice into an alcoholic beverage. During fermentation yeast interact with sugars in the juice to create ethanol, commonly known as ethyl alcohol...g fermentation yeast interact with sugars in the juice to create ethanol, ... The risk of stuck fermenta...
Other TagsBAFFNeuroDNeuroD
(Date:12/6/2009)... Internet Sleep Disorders information and Treatment site ... sleep problems with herbal or natural sleep aids ... ,insomnia remedies for a good cause. The submissions ... Natural Sleep Aids ,Encyclopedia, by YOU, to be ... The site will donate 100% of the proceeds ...
(Date:12/5/2009)... What: Cuts for a Cause ,, Why: ... and other terminal illnesses affecting children. All proceeds from each ... Research Hospital. Guests will enjoy complimentary beverages and hors d,oeuvres, ... in Falls Church for all guests. Hoa Lai, a DJ ...
(Date:12/5/2009)... wrong with being single, myth , , SATURDAY, Dec. 5 (HealthDay ... 40th birthday without ever tying the knot, since research has ... folks. And, um, isn,t there something wrong with those who ... new study looking at psychological measures shows that never-married people ...
(Date:12/4/2009)... ALTO, Calif., Dec. 4 Varian Medical Systems (NYSE: ... has set the regular 2010 Annual Meeting of Stockholders for ... 2009. The meeting will be held at the Crowne Plaza ... 4:30 p.m. PT. ,, The meeting will be webcast by ...
(Date:12/4/2009)... The American Association of Homes and Services for the ... Community Living and Supportive Services (CLASS) provisions remain in the ... for providing support to elders, people with disabilities and their ... health care reform bill that will make it affordable to ...
Breaking Medicine News(10 mins):Health News:Donate a Herbal Natural Sleep Aid to the Internet's First "Natural Sleep Aids E-book" Written by People Just Like You 2Health News:Never Married, Over 40, Well-Adjusted 2Health News:Never Married, Over 40, Well-Adjusted 3Health News:Varian Medical Systems Schedules Annual Stockholder Meeting in Palo Alto 2
(Date:12/3/2009)... Now in its 32nd year, the CTRC-AACR San ... in breast cancer science and world leaders from industry ... , This year, more than 8,500 scientists and ... Convention Center in San Antonio from Dec. 9-13, 2009. ...
(Date:12/3/2009)... must be included in the design of the upcoming forest ... according to a scientist at the University of Leeds. ... argues that at least 50% of the carbon credit payments ... from Deforestation and Degredation), should be made to forest dwellers ...
(Date:12/2/2009)... cigarette smoke have an increased risk of developing lung cancer ... of this study are published in Cancer Epidemiology, Biomarkers ... Cancer Research, as part of a special tobacco focus in ... 219,000 Americans will be diagnosed with lung cancer; more than ...
Breaking Biology News(10 mins):CTRC-AACR San Antonio Breast Cancer Symposium continues to expand 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Secondhand smoke exposure in childhood increases lung cancer risk later in life 2Cystic Fibrosis Foundation Receives Second 4 Star Rating from Charity Navigator for Exceptional Fiscal Management 54308 1Cystic Fibrosis Foundation Receives Second 4 Star Rating from Charity Navigator for Exceptional Fiscal Management 54308 2New Audio Podcast Provides an Insider 26apos 3Bs View of the Healthcare System 54307 1New Audio Podcast Provides an Insider 26apos 3Bs View of the Healthcare System 54307 2New Audio Podcast Provides an Insider 26apos 3Bs View of the Healthcare System 54307 3Fountain Healthy Aging Inc Announces 245 000 000 Equity Line Of Credit Investment Secured 54304 1Fountain Healthy Aging Inc Announces 245 000 000 Equity Line Of Credit Investment Secured 54304 2Fountain Healthy Aging Inc Announces 245 000 000 Equity Line Of Credit Investment Secured 54304 3
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesis