Navigation Links


Imaging in Medical News

Hitachi Medical Systems and Monarch Medical Announced as Co- Title Sponsors of the Health Connect Partners' 2009 Fall Radiology and Imaging Conference

LEBANON, Tenn., July 31 /PRNewswire/ -- Health Connect Partners, Inc. ( www.hlthcp.com ) announced today that Hitachi Medical Systems and Monarch Medical have signed on as Co- Title sponsors of its 2009 Fall Radiology and Imaging Conference. The 2009 Fall Radiology and Imaging ...

Are imaging features of hepatic angiomyolipoma related to its clinical setting?

This study consisted of 10 patients (three male and seven female) with hepatic angiomyolipoma, with a mean age of 55.1 years (age range, 19-78 years). Of these patients, dynamic contrast CT showed hepatic angiomyolipoma as a hypervascular mass with intratumoral fatty density, absence of a capsule,...

VA Medical Imaging Reaches Record Level

WASHINGTON, July 24 /PRNewswire-USNewswire/ -- VistA Imaging, the medical and health care imaging system used in Department of Veterans Affairs (VA) medical centers, attained over one billion stored images in January this year, according to the department. "Using this tec...

Brookhaven Lab and Hybridyne Imaging Technologies Inc., win R&D 100 award

UPTON, NY The U.S. Department of Energy's Brookhaven National Laboratory and Hybridyne Imaging Technologies, Inc., of Toronto, Canada, have won a 2009 R&D 100 Award for developing a compact gamma camera for high-resolution imaging of prostate cancer. The camera system, called ProxiScan, is a nucl...

Growth in African Medical Imaging Markets: Frost & Sullivan Examines the Potential

CAPE TOWN, South Africa, July 21 /PRNewswire/ -- Adverse economic conditions, the rising cost of healthcare and decreased donor funding to sub-Saharan Africa are posing major challenges to the medical imaging markets in many countries in the region. Price sensitivity and competition in t...

American Imaging Management Debuts Patient Safety Podcasts

CHICAGO, July 14 /PRNewswire/ -- American Imaging Management((R)) (AIM((R))), an operating subsidiary of WellPoint, Inc. (NYSE: WLP ), and leading imaging benefit management and technology company with health plan clients representing more than 35 million consumers, announced...

More>>

Imaging in Medical Technology

VisEn Molecular Imaging Technology Enables Key Insights Into Newly Discovered Biologic Pathway Published in SCIENCE

BEDFORD, Mass., July 30 /PRNewswire/ -- VisEn Medical Inc., a leader in fluorescence in vivo imaging from research through medicine, announced today that scientists reporting in the July 31 issue of SCIENCE have discovered a key disease-related biologic pathway using an integrated and ...

Elbit Imaging Ltd. Announces - Swiss Team Uses InSightec's ExAblate(R) 4000 Brain System to Treat Patients With Functional Brain Disorders

TEL AVIV, Israel, July 14 /PRNewswire-FirstCall/ -- Elbit Imaging Ltd. (TASE: EMIT, Nasdaq: EMITF ), announced today that, its subsidiary (in which EI holds indirectly approximately 58.34%, InSightec Ltd., announced today that a team at the University Children's Hospital Zurich has completed...

Perceptive Informatics Introduces Medical Imaging Methodology to Accelerate Development Decisions About Alzheimer's Treatments

BOSTON, April 30 /PRNewswire-FirstCall/ -- Perceptive Informatics, the industry's leading eClinical solutions provider and a subsidiary of PAREXEL International Corporation (Nasdaq: PRXL ), today announced that it has developed a robust medical imaging methodology for Central Nervous System (CNS...

New Imaging Analysis Predicts Brain Tumor Survival

U-M researchers develop 'parametric response map' to analyze changes in a tumor's blood flow, volume ANN ARBOR, Mich., April 20 /PRNewswire-USNewswire/ -- As early as one week after beginning treatment for brain tumors, a new imaging analysis method was able to predict which patients would li...

Varian Medical Systems to Exhibit Cancer Treatment and X-ray Imaging Technologies at China Med Exhibition

Varian to showcase products ranging from treatment planning software for radiation therapy to flat panel detectors for filmless X-ray imaging BEIJING, March 16 /PRNewswire-FirstCall/ -- Varian Medical Systems, Inc. (NYSE: VAR ) will showcase the full spectrum of the company's cancer treatme...

VirtualScopics' Quantitative Imaging Provides Primary Endpoint in Cartilage Repair Pivotal Clinical Trial

Pioneering study uses quantitative imaging endpoints from MRI analyses ROCHESTER, N.Y., March 12 /PRNewswire-FirstCall/ -- VirtualScopics, Inc. (Nasdaq: VSCP ), a leading provider of quantitative imaging for clinical trials, today announced that BioSyntech Inc., a Canadian medical device co...
Imaging in Medical Products

Kowa nonmyd -D 5MEGA / VK-2 Digital Imaging System

Description: ...
Company:Kowa Optimed, Inc

D-SPECT Cardiac Imaging System

Description: Spectrum Dynamics empowers Nuclear Imaging with the SmartR Technology of the D-SPECT Cardiac Imaging System. The D-SPECT is powered by BroadView Technology to provide unprecedented throughput, while not only maintaining, but improving resolution....
Company:Spectrum Dynamics

iLab Ultrasound Imaging System

Description: Look to the intuitive iLab System to deliver the best IVUS image quickly and easily. This easy-to-use installed system with tableside controller is the Clear Choice for IVUS....
Company:Boston Scientific Corporation

DP-6600 Digital Ultrasonic Diagnostic Imaging System

Description: Digital Ultrasonic Diagnostic Imaging System...
Company:Mindray

DP-9900Plus Digital Ultrasonic Diagnostic Imaging System

Description: Digital Ultrasonic Diagnostic Imaging System...
Company:Mindray

PHORESIS Imaging System

Description: The Phoresis is a state-of-the-art digital imaging system which allows scanning and storage of electrophoresis results from any Sebia gel including immunofixation. This system provides benefits to any size laboratory....
Company:Sebia Electrophoresis

More>>

Imaging in Medical Definition

Artificial induction of immunity

...used by a bacterium , and rabies is known to be caused by a virus . The microscopes of the time could reasonably be expected to show bacteria, but imaging of viruses had to wait until the development of electron microscopes with their greater resolving power in the 20th century. Toxoids Som...

Full-body scan

...r "optical" colonoscopy . One of the downsides of imaging is that although they provide comparable detection...Carotid artery . [1] [2] Magnetic resonance imaging (MRI) scans are associated with a lesser radiatio...dy screening and staging with MRI.". J Magn Reson imaging 24 (3): 489-498. PMID 16888774 . ...

Medical procedure

...copy Esophageal motility study Medical imaging Angiography Cerebral angiography Cor...ography Abreugraphy Magnetic resonance imaging Diffuse optical imaging Diffusion-weighted...

Medicine

...physical examination , combined with laboratory or imaging studies (investigations)) analyze and synthesize...scopy units, diagnostic laboratory and medical imaging services, hospice centers, etc. Some primary ca... physical examination , appropriate laboratory or imaging studies, analysis of data and medical decision mak...

Neuropsychiatry

...e behavioural disorders have been linked to identical neurodysfunction with imaging but show significant organic differences following neurohistological analy....H., Bailer, U.F., Frank, G.K., Wagner, A., & Henry, S.E. (2005). Brain imaging of serotonin after recovery from anorexia and bulimia nervosa. Physiology &...

Nuclear medicine

...r medicine is a branch of medicine and medical imaging that uses the nuclear properties of matter in dia... the formation of an image using a gamma camera . imaging may also be referred to as radionuclide imaging or nuclear scintigraphy . Other diagnostic tests...
Imaging in Medical Dictionary

X-Ray

...gging system for batch programs. ... All XRAY facilities are accessible via clearly informative menu screens. ... Wolf Xray - Manufacturers of imaging Accessories ... In addition, historical data of x-ray exposure can prove vital in the event of ... ...

Urogenital

...diagnosis, and treatment Shop for Urogenital imaging - Books at Shop.com. Urogenital imaging Books|Non-Fiction|English |Paperback|Berry|Anshan|... Analgesic Nephropathy. Bladder Cancer ... Buy imaging Of Urogenital Diseases for $151.20 today & s...

Ungual

...rsal aspect of the ungual crest. ... Ungual : Metastatic Melanoma resources and information at ungual .com. ... Melanoscan® Full-Body Digital imaging Helps Dermatologists Reduce Spread of ... Bartleby.com publishes thousands of free online classics of reference, literature and nonfiction ... Buy...

Ultrasound

...n to person, it is approximately 20 kilohertz (20,000 hertz) in healthy, young adults... Diagnostic sonography is an ultrasound -based diagnostic imaging technique used to visualize subcutaneous body structures including tendons, muscles, joints, vessels and internal organs for possible pathology or...

Urinary tract

...ary tract infections (UTI's) account for about 8 ... Urinary tract infections (UTIs) usually occur as a consequence of colonization ... imaging evaluation of the urinary tract following a UTI should be individualized, ... Urinary tract infections (UTIs) are responsible for more t...

Transillumination

...sthmian. transistor. transistor radio ... Vein imaging with Transillumination for Sclerotherapy, Laser ... Medicine Vein Finder for Vein Access and Vein imaging with Transillumination for Sclerotherapy Laser T...t intensity can be controlled by a knob on ... imaging of Pigmented Lesions for Early Skin Cancer Detecti...
Imaging in Biological News

Scary ancient spiders revealed in 3-D models, thanks to new imaging technique

Early relatives of spiders that lived around 300 million years ago are revealed in new three-dimensional models, in research published today in the journal Biology Letters . Scientists at Imperial College London have created detailed 3D computer models of two fossilised specimens of ancient c...

Jet-propelled imaging for an ultrafast light source

John Spence, a physicist at Arizona State University, is a longtime user of the Advanced Light Source at Lawrence Berkeley National Laboratory, where he has contributed to major advances in lensless imaging. It's a particularly apt propensity for someone who works with x-rays, since they can't be ...

Kornberg Associates Architects Selected to Develop Design for New Stanford University Imaging Center

MENLO PARK, Calif., June 29 /PRNewswire/ -- Kornberg Associates | Architects ( www.kornberg.com ) has been selected by Stanford University to design a new Cognitive & Neurobiological Imaging Center. Ken Kornberg, president and founder, made the announcement. The firm has worked with Sta...

Lyncean Technologies Inc. receives $1.2 M from NCRR to develop new imaging technique

Lyncean Technologies, Inc. has just received a Phase I SBIR grant of $1,296,403 from the National Center for Research Resources (NCRR) to develop "Differential Phase Contrast Imaging" using the unique x-ray beam produced by the Compact Light Source (CLS). The grant will allow Lyncean to continue ...

Ultrasound imaging now possible with a smartphone

Computer engineers at Washington University in St. Louis are bringing the minimalist approach to medical care and computing by coupling USB-based ultrasound probe technology with a smartphone, enabling a compact, mobile computational platform and a medical imaging device that fits in the palm of a...

Studies on imaging and tracking transplanted cells

Tampa, Fla. (Dec. 10, 2008) Successfully monitoring the distribution and fate of transplanted stem cells through imaging and subsequent tracking would aid clinicians in their ability to evaluate the efficacy of transplanted cells. Three studies published in the current issue of Cell Transplantat...

More>>

Imaging in Biological Technology

Patent Awarded for a New X-ray Imaging Technology with Capability Unrealized with Present Day Radiological Modalities

Now, a newly patented x-ray microscope technology makes it possible to see every wire in a stent, magnified 25 times larger than actual size, as clearly as if it were being viewed through a microscope, while exposing the animal and researcher to significantly less radiation than current FDA dosa...

RadMD First to Offer CME-Certified Education and Training For Medical Imaging in Clinical Trials

DOYLESTOWN, Pa., July 28 /PRNewswire/ -- RadMD, Inc. ( www.rad-md.net ) has become the first company to offer a broad range of accredited CME courses in the area of medical imaging for pharmaceutical, medical device and biotech clinical trials. The comprehensive education a...

NEW Momentum(TM) Physician and Staff Scheduling Software for Imaging Centers, OB/GYN, and Other Specialty Practices Improves Productivity and Equity in Scheduling

ROCHESTER, N.Y., July 14 /PRNewswire/ -- Bio-Optronics, Inc., a leader in healthcare workflow software, announces Momentum((TM)) Physician and Staff Scheduler, an intelligent, hosted software solution that can simultaneously handle the most intricate scheduling policies, demand, personal requ...

Powerful Image Registration and Recognition Software Unveiled for Medical, Satellite, and Defense Imaging Industries

Image Registration and Recognition Software developed by Dr. Charles Stewart at DualAlign LLC is breaking new ground in medical imaging, satellite imaging and defense imaging. The breakthrough software is helping professionals automatically align and stitch images even if the originals were taken...

VisEn Launches New Cat-K FAST(TM) Fluorescence Molecular Imaging Agent

BEDFORD, Mass., July 7 /PRNewswire/ -- VisEn Medical Inc., a leader in fluorescence in vivo imaging from research through medicine, announced today the commercial launch of its new Cat-K FAST (TM) imaging agent for measuring and monitoring Cathepsin K activity associated with disease progr...

Kornberg Associates Architects Selected to Develop Design for New Stanford University Imaging Center

MENLO PARK, Calif., June 29 /PRNewswire/ -- Kornberg Associates | Architects ( www.kornberg.com ) has been selected by Stanford University to design a new Cognitive & Neurobiological Imaging Center. Ken Kornberg, president and founder, made the announcement. The firm has worked with Sta...

More>>

Imaging in Biological Products

CoverWell imaging chamber gasket with adhesive, one chamber, 20 mm diameter, 1.0 mm deep *set of 40* from Molecular Probes (Invitrogen)

Description: CoverWell imaging chamber gasket with adhesive, one chamber, 20 mm diameter, 1.0 mm deep *set of 40* Cell Biology Imaging Tools and Accessories Microscope Slide Accessories...
Company:Molecular Probes (Invitrogen)

Thermal Grayscale USB Printer for Imaging Systems; USB Connection from Alpha Innotech

Description: Includes USB cable, custom driver and one roll of thermal paper...
Company:Alpha Innotech

Wheat Germ Agglutinin (WGA) PS SPA Imaging Bead from GE Healthcare, formerly Amersham Biosciences

Description: Wheat Germ Agglutinin (WGA) PS SPA Imaging Bead, 2 g. Category: Leadseeker Beads....
Company:GE Healthcare, formerly Amersham Biosciences

NIS-Elements Imaging Software from Nikon

Description: Nikon's NIS-Elements revolutionizes imaging software for the microscopy market by combining automated intelligence to microscopes, cameras, components and peripherals with powerful archiving, analysis, visualization and achiving tools. Its intuitive interface simplifies workflow and speeds up i...
Company:Nikon

Molecular Imager VersaDoc MP 4000 Imaging System, PC/Mac from Bio-Rad

Description: The Bio-Rad Molecular Imager VersaDoc MP 4000 System is a versatile and quantitative CCD based imaging system capable of supporting a wide array of detection methods, including fluorescence, chemiluminescence, densitometry, and chemiflourescence. Red, Green, and Blue illumination sources allow ima...
Company:Bio-Rad

MetaVue from Universal Imaging Corporation (a subsidiary of Molecular Devices)

Description: ...
Company:Universal Imaging Corporation (a subsidiary of Molecular Devices)

More>>

Imaging in Biological Definition

Magnetic resonance imaging

Magnetic Resonance Image Magnetic resonance imaging ( MRI ) is a method of creating images of the inside of opaque organs in living organisms as well as detecting the amount of bound water in geological structures. It is primarily used to demonstrate pathological or other physio...

Biophysics

...s muscle and contractility nucleic acids photobiophysics and biophotonics proteins supramolecular assemblies spectroscopy , imaging etc. systems neuroscience neural encoding bionics polysulphur membranes Famous biophysicists Luigi Galvani , discoverer o...

Brain

...rain and very little sub-cortical activity. Functional magnetic resonance imaging (fMRI) measures changes in blood flow in the brain, but the activity of ne...t Dale , Arvid Carlsson and many others. Later techniques, such as brain imaging allowed scientists to study the brain in living humans and animals in ways...

Cancer

...efits and risks of diagnostic procedures and treatment be taken into account when considering whether to undertake cancer screening. Use of medical imaging to search for cancer in people without clear symptoms is similarly marred with problems. There is a significant risk of detection of an incidentalom...

Computed axial tomography

... medicine in 1979 ( See also history of brain imaging ). The first scanner took several hours to acquir...970s , CT has become an important tool in medical imaging to supplement X-rays and medical ultrasonograp...sed but is less sensitive than magnetic resonance imaging (MRI). CT can also be used to detect increases ...

Karyotype

...fluorochromes. Chromosomes can be automatically identified in fluorescence microscopy through an interferometer and a computer analysis (spectral imaging ) See also genome screen External links Try making a karyotype yourself , from the University of Utah's Genetic Science Learni...
Imaging in Biological Dictionary

Ureters

...kidneys, ureters and urinary bladder that uses ... Kidneys, ureters , and bladder. From Wikipedia, the free encyclopedia. Jump to: ... medical imaging technique and stands for kidneys, ureters , and bladder. ... Lifestyle, fitness & health information about Ureters . ... opathy is the pres...

Scrotum

...um , making it easier to spot anything abnormal) ... Current and accurate information for patients about Scrotal Ultrasound. ... What is Ultrasound imaging of the Scrotum ? What are some common uses of the procedure? ... Undescended testicle - Overview, Undescended testicle occurs when one or both tes...

Right ventricle

...d to the very ... The Right Ventricle ... From the right ventricle , the pulmonary artery is the pathway for deoxygenated ... INTRODUCTION imaging the right ventricle is an essential and highly informative ... The normal right ventricle can be recognized by a number of ... The right ...

Reporter Gene

...n a transfected cell. ... of one of the most famous reporter genes , GFP, was awarded the Nobel prize last year. ... PET-based reporter gene imaging was developed approximately 12 years ago, and the technology is beginning to be translated into specific clinical a ...

Renal arteries

...tery Stenosis (Magnetic Resonance Angiography) ... Review Article from The New England Journal of Medicine -- Renal - Artery Stenosis ... Duplex imaging of the Renal Arteries with Contrast Enhancement. ... about an 82-year-old woman with hypertension and renal artery stenosis. SYMPTOMS ... ...

Protein array

...an in vitro translation ... Creating this nucleic acid programmable protein array in situ was easier and ... Applications for the Odsssey imaging System - Protein Array ... Using IR fluorescence to detect your protein arrays will give you ... Odyssey Accessories - Protein Array An...
Other TagsLeadershipFiberFiberFiberFiberOshkoshGenzymeDoctorDoctorOpportunitiesOpportunitiesRural
(Date:11/20/2009)..., WASHINGTON, Nov. 20 T...ators to modify health care reform legislation rel...ding a health insurance individual coverage mandat...eable mandate will minimize adverse selection stem...prescribed by the bill. ,, "The individual mand...
(Date:11/20/2009)... Senators and Congressmen in Competi...their Health Care Vote , ...rs and congressmen running for re-election next ye...guru Charlie Cook, may come to regret voting for H..., according to a breaking Zogby International/ O&r...
(Date:11/20/2009)..., ST. LOUIS, Nov. 20 ... that it will present at the Bank of America Merri...er 2-3, 2009, at the Crowne Plaza Hotel Times Squa...dnesday, December 2nd at 8:30 a.m. Eastern Time. I... live, audio webcast of Centene,s presentation at:...
(Date:11/20/2009)...AS VEGAS, Nov. 20 The f...e Director of the Nevada Health Care Association: ...ommends and thanks Senate Majority Leader Harry Re...closer toward our goal of protecting every Nevada ...re, and preserving the strength and viability of o...
(Date:11/20/2009)...tions of exposure to formaldehyde used for embalmi... increased risk of death from myeloid leukemia, ac...0 in the Journal of the National Cancer Institute...y from lymphohematopoietic malignancies and brain ...dustry workers, all of whom may have worked with f...
Breaking Medicine News(10 mins):Health News:Actuaries to Senate: Strengthen Individual Mandate 2Health News:Just 25% of Voters in Competitive 2010 Senate Races “Much More Likely” to Support Pelosi-Democrats Who Voted for Health Care Bill 2Health News:Just 25% of Voters in Competitive 2010 Senate Races “Much More Likely” to Support Pelosi-Democrats Who Voted for Health Care Bill 3Health News:Funeral industry workers exposed to formaldehyde face higher risk of leukemia 2
(Date:11/20/2009)...chers are at work on many scientific and technolog...s recently provided support that totals nearly $4.... investigators under the American Recovery and Rei... been awarded grants for investigation of solar ph...of physics, will enhance the capabilities of NJIT,...
(Date:11/20/2009)...precise measurements of plasma lipoprotein concent...pectroscopy (NMR), researchers led by Daniel Chasm...ical School in Boston, MA, the Framingham Heart St... Stockholm, Sweden and Oxford, England performed g...e among 17,296 women of European ancestry from the...
(Date:11/20/2009)..., DC Nov. 20, 2009) Scientists from the Marine B... of the Naval Research Laboratory (NRL) organized ...ists on an Arctic expedition to initiate methane h...ne the spatial variation of sediment contribution ...oast Guard Cutter Polar Sea as a research platform...
Breaking Biology News(10 mins):NJIT receives NSF funding to improve Big Bear Telescope, study solar energy 2Genetic analysis helps dissect molecular basis of cardiovascular disease 2International expedition investigates climate change, alternative fuels in Arctic 2SpectraScience Secures Distribution for WavSTAT 28R 29 Cancer Diagnosis System in France 50899 1SpectraScience Secures Distribution for WavSTAT 28R 29 Cancer Diagnosis System in France 50899 2SpectraScience Secures Distribution for WavSTAT 28R 29 Cancer Diagnosis System in France 50899 3VerteLoc 26amp 3B 238482 3B Tops 500 Surgical Procedures VGI Announces VerteLX 26amp 3B 238482 3B and Seeks Potential Investors for Growth 12915 1VerteLoc 26amp 3B 238482 3B Tops 500 Surgical Procedures VGI Announces VerteLX 26amp 3B 238482 3B and Seeks Potential Investors for Growth 12915 2Connectyx Technologies Holdings Group Inc Increases Revenues by 45 25 and Reduces Expenses by 20 25 for the Second Quarter of 2009 Versus Second Qua 50893 1Connectyx Technologies Holdings Group Inc Increases Revenues by 45 25 and Reduces Expenses by 20 25 for the Second Quarter of 2009 Versus Second Qua 50893 2Connectyx Technologies Holdings Group Inc Increases Revenues by 45 25 and Reduces Expenses by 20 25 for the Second Quarter of 2009 Versus Second Qua 50893 3
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesisclade