Navigation Links


ignored in Medical News

Domestic AIDS Epidemic Ignored at Republican National Convention

Advocates call on John McCain to commit to develop a National AIDS Strategy for the U.S. MINNEAPOLIS and ST. PAUL, Minn., Sep. 5 /PRNewswire-USNewswire/ -- The Republican National Convention concluded last night with no mention of the domestic AIDS epidemic in the United States and only pass...

Patients' relatives are ignored by the health system and suffer emotional stress

This release is available in Spanish . There are people who have traditionally been forgotten in the field of health. However, they are vitally important for patients well-being: they are the family caregivers in hospitals. A study carried out at the Department of Social Anthropology of...

Treating oft ignored non-cancer health issues after cancer diagnosis prolongs survival

INDIANAPOLIS Receiving treatment for non-cancer health issues while being treated by specialists for cancer improves cancer survival rates according to a study published in the December 20 issue of the Journal of Clinical Oncology. The study, by researchers from the Indiana University School o...

Bottle-Feeding Moms Ignored

Many feel pressured to breast-feed and ill-informed about alternative, researchers find TUESDAY, July 14 (HealthDay News) -- The lack of information and support for mothers who bottle-feed could put the health of their infants at risk, say British researchers who reviewed 23 studies t...

Guidelines for care of elderly patients ignored

Guidelines for the treatment of older patients with respiratory conditions are routinely ignored. Research published today in the open access journal BMC Health Services Research shows that recommended treatments are given to only a small minority of eligible patients. Benjamin Craig from the...

Palace of Westminster Asbestos Problem Ignored

LONDON, June 16 /PRNewswire/ -- Clinica - the world's leading news service for the medical technology industry - has learned that staff and visitors to London's Houses of Parliament have been at risk of exposure to high levels of asbestos contamination for significant periods during the last t...

Sun Protection Ignored Despite Warnings

In spite of increased concern over skin cancer many people still disregard the use of sunscreen to protect their skin. In a recently concluded survey it was noticed that one in three Briton do not protect their skin from the sun. More than 75,000 new cases of skin cancer are diagnosed in the ...

Mental Health Ignored in British Business

According to a disability charity British businesses are ignoring the mental health of its workers, a situation that was at odds with their concern for physical health//. Following legislation, pressure from unions and insurers most employers have set up several health and safety systems to gua...

Skipped heartbeats should not be ignored

Heart beat has a basic rhythm in which it beats. The infrequent skipped heart beat is not serious, but when there is a sustained heart rhythm abnormality,// medical advice is immediately needed. Most people will have experienced so-called arrhythmias from time to time, in other words a missed heart...

Spam Mails about Lipstick Causing Cancer to Be Ignored

Sophos's global network of virus, spyware and spam analysis centers, have warned users not to fall for a chain letter that is spreading across the internet.// This letter claims that lipstick causes cancer. The emails claim that some brands of lipstick contain a dangerously high level of le...

More>>

ignored in Medical Technology

Another Study Links Fluoride to Bone Cancer

...oung males in fluoridated vs. unfluoridated regions of New Jersey.(3) More studies link fluoride to bone and other cancers but are downplayed or ignored by government officials.(4)(5) Bone defects similar to bone cancer were detected in fluoridated Newburgh, NY children as early as 1955. Newburgh...

ACRO Comments on NEJM Article on Globalization of Clinical Research

...t process. However, the globalization of the clinical trials enterprise is a complex endeavor involving many factors. Unfortunately, the authors' ignored one of the primary drivers behind the globalization of clinical research: the limited participation rate in clinical trials in the United States and W...

CureHIV Reaches Out to Bill and Melinda Gates to Fund LiSAVIOR

...rature and humidity. "I am thinking in terms of problem solving. Traditional commercial drug design and projects funding from the NIH has completely ignored this approach to date," stated Dr. Hershline. "I think we have to talk in terms of a cure for HIV. I want to cure HIV and that is why my foundation is...

Statement by Philip Home Chairman of the RECORD Study Steering Committee and Professor of Diabetes Medicine at Newcastle University in England

...misleading in that they disregarded important pieces of data that are extremely relevant to patients and physicians. Most significantly the editorials ignored data that showed no evidence of any increase in cardiovascular death or death from any cause." Professor Philip Home CONTACT: Professor Philip Hom...

Pelosi: Bush Veto of Stem Cell Bill Says 'No' to the Hopes of Million of Families Across America

...Speaker Nancy Pelosi issued the following statement today in response to President Bush's veto of the stem cell bill: "Once again, the President has ignored the will of the American people, of leading medical researchers, and of a bipartisan majority of the Congress. His cruel veto says 'no' to the hopes o...

President Bush Ignores America's Plea for Support of Stem Cell Research

...ntinue to rely on factually incorrect information and the political pressure of an extremist minority on this issue. "With this veto, President Bush ignored the overwhelming majority in the medical, scientific, and spiritual communities who believe stem cell research holds the key to unlocking the future o...
ignored in Medical Products

Carl Zeiss WASCA Analyzer/Aberrometer

Description:...tire eye from thecornea to the retina. In addition to refractive values, the WASCA Analyzer also supplies higher order aberrations which were largely ignored in the past. The WASCA Analyzer provides you with an objective result for an exact diagnosis. It will help you to select the most suitable form of the...
Company:Carl Zeiss Meditec, Inc.
ignored in Medical Definition

Neuropsychiatry

...gh incidence of traditionally psychiatric symptoms, like psychosis and depression (Lerner and Whitehouse, 2002). These symptoms, which are largely ignored in neurology (Yodofsky and Hales, 2002), can be addressed by neuropsychiatry and lead to improved patient care. In sum, it is argued that patients f...
ignored in Medical Dictionary

Vestibular Disorders

... and various treatments ... the diagnosis, treatment and care of vestibular disorders . ... Vestibular disorders are completely missed or ignored in the vast majority head injury cases. ... Interaction of somatoform and vestibular disorders . ... a persisting vestibular dysfunction ca...

Tachypnea

...eturn to top ... Tachypnea may have little to no impact on the affected individual, especially in ... For this reason, tachypnea should not be ignored and addressed if it persists or ... Lab Values. Lab Tests Online. What is being tested and why. How the sample is taken. ... Low values = Anemia...

Daily life

...is a common notion in modern existence – although more so in more... Daily Life Until the mid-twentieth century, professional historians often ignored the details of everyday life as antiquarian , in the sense of Daily Life in the Middle Ages : COOL site! ... Medieval Women Writers - Introd...
ignored in Biological News

Scientific information largely ignored when forming opinions about stem cell research

MADISON - When forming attitudes about embryonic stem cell research, people are influenced by a number of things. But understanding science plays a negligible role for many people. That's the surprising finding from a team of University of Wisconsin-Madison communications researchers who have...

Fungi the cause of many outbreaks of disease but mostly ignored

Fungi can cause a number of life-threatening diseases but they also are becoming increasingly useful to science and manufacturing every year. However, many people, scientists among them, are largely unaware of the roles fungi play in the world around us. Research on fungi and fungal diseases are ...

$2 million grant aids study of lung cancer in people who never smoked

...parate category, it ranks as the seventh-most common cause of cancer deaths worldwide," Dr. Gazdar said. "Lung cancer among never-smokers is really an ignored disease, yet it is such a major killer." Research has shown that lung cancer in people who have never smoked differs in many ways from the disease ...

New nanoparticles could revolutionize therapeutic drug discovery

...These new findings, which have just been published online in the Journal of the American Chemical Society , will give scientists access to previously ignored proteins deemed too unstable to work with. Professor Michael Overduin, from the University of Birmingham, who led the study, explained: "We have sh...

'Shortcuts' of the mind lead to miscalculations of weight and caloric intake, says Penn study

... even though height information was provided in the photographs or directly available with live models. Meanwhile, participants devalued or completely ignored other parameters critical to an accurate judgment. Penn psychologists point to the study as a novel example of the negative artifacts packaged with...

U of Minnesota research reveals critical role of evolutionary processes in species coexistence

...h Network Office, the National Science Foundation and the Natural Sciences and Engineering Research Council of Canada. "For a long time, ecologists ignored the importance of evolutionary processes in understanding how species coexist and how diversity is maintained," said Jeannine Cavender-Bares, a profes...

NIH announces new program to develop therapeutics for rare and neglected diseases

...dictate. Its strategies will be similar to approaches taken by pharmaceutical and biotechnology companies, but TRND will be working on diseases mostly ignored by the private companies. Importantly, TRND will also devote effort to improve the drug development process itself, developing new approaches to acce...

For cancer cells, genetics alone is poor indicator for drug response

... very well to a particular cancer treatment, whereas "group B" does not. They will then often compare group A to group B to find out why. But often ignored is that not every cell in either group behaves in ways that the aggregate indicates. In a group of cells shown to be vulnerable to a particular cancer...

Team identifies a molecular switch linking infectious disease and depression

...pment of new antidepressant drugs. The study also demonstrates the robust link between the immune system and the nervous system, a connection often ignored by immunologists and neurologists, Kelley said. To reduce this barrier between the two fields of study, Kelley and Dantzer launched the Integrative...

American Chemical Society's weekly PressPac -- March 11, 2009

...cts that tell secrets of ancient societies, Rowe said. "Because of the prior lack of methods for dating rock art, archaeologists had almost completely ignored it before the 1990s," he explained. "But with the ability to obtain reliable radiocarbon dates on pictographs, archaeologists have now begun to incorp...
ignored in Biological Technology

Scientist takes back patents and develops product others ignored

Madison, Wis. Mark Cook, a tenured animal sciences professor at the University of Wisconsin-Madison, had seen his patents get licensed out to several businesses, only to sit on the shelves. Hed been working since the mid 1980s on biotechnology that was was not being promoted by any of the bus...

Xmark Requests That Icagen Oust Its CEO and Pursue Strategic Alternatives, and Calls on Board Members to Resign

...B. Evnin, Managing General Partner of Venrock Associates, should resign, as they have been front and center in our dialogue with the company, and have ignored our sound advice. Respectfully submitted, XMARK OPPORTUNITY PARTNERS, LLC About the Xmark Funds The Xmark Funds ar...

Cytopia Letter to Progen Shareholders

... $9.49 in April 2007 to around $0.82, below cash backing; The board recently commissioned strategic recommendations for Progen but has largely ignored them. For over seven months, institutional and retail shareholders have been asking for choice in how their capital is dealt with. T...

IDRI Collaborates with the Brazilian Butantan Institute To Develop Novel Vaccines Against Leishmaniasis

...of visceral leishmaniasis occur each year, and 10% of these patients, who are mostly children, will die. "For too long, the world has virtually ignored the dramatic burden of leishmaniasis on poor populations and limited efforts have been dedicated to the research of new tools against the disease. Tod...

From Race Cars and Google Doodles to Day Spas and Night Lights: Groups Across the U.S. Prepare to Join World Diabetes Day Celebrations on November 14

...at 75,000 children with type 1 diabetes worldwide cannot access the medication, monitoring and education they need to survive. This story goes largely ignored and these children remain in the shadows to face an uncertain future. We aim to bring diabetes to light." The Federation issued a call to action to ...

Anti-Stem-Cell-Research Ad Ignores Facts

...atient safety and privacy." Thus, the proposal itself provides for state regulation of this area. Opponents of Proposal 2 appear to have intentionally ignored and under-played this fact in an attempt to scare people. In addition to the potential for state regulation, there are also federal laws that would ...

Forward step in forecasting global warming

...the area of electron microscopy, and the paper's lead author. So-called brown carbons a nanoscale atmospheric aerosol species are largely being ignored in broad-ranging climate computer models, Crozier and Anderson say. Studies of the greenhouse effect that contribute directly to climate change ha...

Physicists saved from drowning in complexities of wetting theory

...d between the solid surface it sits on and the air above it, which have not been included in any previous formula. Previous descriptions have all ignored or misrepresented these interactions and consequently were at odds with experimental results and computer simulations. The new formulation appears t...

Cure HIV Reaches Out to Foundation Community to Fund LiSAVIOR

...rature and humidity. "I am thinking in terms of problem solving. Traditional commercial drug design and projects funding from the NIH has completely ignored this approach to date," stated Dr. Hershline. "I think we have to talk in terms of a cure for HIV. I want to cure HIV and that is why my foundation is...

Masimo Launches Patient SafetyNet and Showcases the Rainbow SET Upgradable Noninvasive Monitoring Platform at 2007 ASA Annual Meeting

...volume of false pulse oximetry alarms generated by conventional pulse oximetry led systems to provide false alarms so often that clinicians ultimately ignored all alarms. Masimo SET reduced false alarms by over 90% and improved detection of true alarms to over 97%, delivering accurate and reliable alarms and...
ignored in Biological Products

Noninvasive Blood Pressure Software from IITC Life Science

Description:... override the automatic process by the click of a mouse. Data can be saved, ignored or deleted at the operators discretion. Any test can be recalled, displayed... override the automatic process by the click of a mouse. Data can be saved, ignored or deleted at the operators discretion. Any test can be recalled, displayed...
Company:IITC Life Science
ignored in Biological Definition

Cloning

...ll develop into an organism genetically identical to the nucleus "donor". Mitochondrial DNA , which is not transferred by this process, is generally ignored as its effects on organisms are thought to be relatively minor. The term clone is used in horticulture to mean all descendants of a single plant...

Evolutionary biology

...der departments in paleontology , zoology and the like). Microbiology has recently developed into an evolutionary discipline. It was originally ignored due to the paucity of morphological traits and the lack of a species concept in microbiology. Now, evolutionary researchers are taking advantage our e...

Gregor Mendel

... plants. Mendel showed that there was particulate inheritance of traits according to his laws of inheritance . However, Mendel's work was largely ignored until the turn of the 20th century, when its significance was understood for the first time. Contents showTocToggle("show","hide") 1 L...

Magnetic resonance imaging

...gradients in the magnetic field could be used to generate two-dimensional images. Mansfield analyzed the gradients mathematically. The Nobel Committee ignored Raymond V. Damadian , who demonstrated in 1971 that MRI can detect cancer, and filed a patent for the first whole-body scanner. He successfully defe...

Species

...eria are met). There is no universal rule to state the smallest allowable difference between two species, but in general, very trivial differences are ignored on the twin grounds of simple practicality, and genetic similarity: if two population groups are so close that the distinction between them rests on a...
ignored in Biological Dictionary

Silent Mutation

... is one that changes the triplet, but leaves the amino acid unchanged. ... Small changes to DNA that were once considered innocuous enough to be ignored are proving to be important in ... to a silent mutation , even though ... New vaccines are being developed that promise to be safer than traditi...

Immune system

...ively to shield you from anything in your world that threatens your life. By rebuilding ... Prior to this, the immune system was not completely ignored by the established ... Did you know that the appendix is part of your immune system ? ... When the immune system is functioning properly, ...

Cladistics

...mammals as furry fish. ... Cladistics measures how closely two or more species are cousins. ... Anagenetic component of evolutionary change is ignored in cladistics . Cladistics is accepted as the best method available for phylogenetic analysis ... Cladistics , or phylogenetic systematics, is ...

Cilium

...lopedia. ... cilium - a hairlike projection from the surface of a cell; provides locomotion ... Though the primary cilium has historically been ignored by scientists, recent ... Retrieved from http://www.newworldencyclopedi a.org/entry/ Cilium ... The Proteome of the Mouse Photoreceptor Sensory C...
Other TagstransferasetransferaseCaymanCorporationCorporationInstrumentsInstrumentsAbcamHYBHYBHYBHYBHYBAntibodyShopCorpCorpCorpCorpUSBUSB
(Date:12/4/2009)... The renowned Center for mind-body medi...g the only natural immuno-boosting herbal suppleme...rveda. , San Diego, Calif...nprecedented illness due to factors such as stress... millions of people around the world are looking f...
(Date:12/3/2009)... With a membership increase of more tha...ement not only as a milestone in its history, but ...ce. Most associations are experiencing a decline i...o;At a time when trade organizations across the na...experiencing unprecedented growth, signaling that ...
(Date:12/3/2009)...INNEAPOLIS, Dec. 3 Children,s Hosp...cipient of the 2009 Leapfrog Top Hospitals Award. ...ering care that is among the best in the nation wh...y. ,, The Leapfrog survey is the only national,...uding mortality rates for common procedures, infec...
(Date:12/3/2009)...EVERLY HILLS, Calif., Dec. 3 Chris...ivine Design Gala and Premier Shopping Event for P...at 50-70% off regular prices. The event kicks off...December 7, 2009, located at 9900 Wilshire Bouleva...rnia. Please visit www.divinedesign.org for mor...
(Date:12/3/2009)...erforms widely used sulfonylureas, but each patien...RSDAY, Dec. 3 (HealthDay News) -- A class of drug...abetes is associated with a higher risk of dying a...n, researchers say. , , Sulfonylureas, long a m... than metformin in a study of oral anti-diabetes d...
Breaking Medicine News(10 mins):Health News:The Chopra Center for Wellbeing Launches Vedamune: An Ayurvedic Supplement to Support The Immune System 2Health News:Florida Medical Association Marks Record Membership Growth 2Health News:Children's Hospitals and Clinics of Minnesota Receives National Recognition for Quality and Efficiency 2Health News:Christian Audigier Represented at Divine Design for Project Angel Food 2Health News:Diabetes Drugs Go Head-to-Head in Study 2Health News:Diabetes Drugs Go Head-to-Head in Study 3
(Date:12/3/2009)...reef fish can undergo a personality change in warm...gesting that climate change may make some species ...of young damselfish on Australia,s Great Barrier R...ish are either consistently timid, or consistently...ven more marked as water temperatures rise. , A ...
(Date:12/3/2009)... dwellers must be included in the design of the up... a humanitarian crisis, according to a scientist a...Nature , Dr Simon Lewis argues that at least 50% o...hagen, known as REDD (Reducing Emissions from Defo...st dwellers directly, and their property rights as...
(Date:12/3/2009)... leads the world when it comes to investment in en...ing and Physical Sciences Research Council (EPSRC)...needed: "Scientific and engineering research has a...ar power solutions, but more investment is needed ... if we are to meet our carbon emission targets by ...
Breaking Biology News(10 mins):Fish with attitude: Some like it hot 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Research is vital to a cleaner, greener, low carbon future 2Small optical force can budge nanoscale objects 14883 1Small optical force can budge nanoscale objects 14883 2MSC Appoints Linda Lane Senior VP Sales and Marketing 61578 1IEHP Ranks 232 in California Among Medicaid Health Plans 61573 1IEHP Ranks 232 in California Among Medicaid Health Plans 61573 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria