Navigation Links


focuses in Medical News

Multi-state Medicare Fraud Crackdown Focuses Attention on Recovery Payoffs to Defray Health Reform Costs

FORT LAUDERDALE, Fla., Aug. 5 /PRNewswire/ -- In the aftermath of 32 recent arrests for Medicare fraud in Houston, Boston and Miami, discussions are now focusing on how massive recoveries by the government can significantly help defray the costs of current health reform initiatives. This late...

Swine Flu Summit Focuses on Preparedness

U.S. taking steps to handle virus' anticipated return in the fall THURSDAY, July 9, 2009 (HealthDay News) -- The initial scare posed by the sudden emergence of swine flu in April may have passed, but federal officials are warning against complacency and taking no chances as they brace ...

Nation's first children's hospital-based safety store focuses on child injury prevention

INDIANAPOLIS The Riley Safety Store at Riley Hospital for Children, the first of its kind in the nation, serves as a model for children's hospitals across the nation. Recently expanded, the Riley Safety Store provides space to showcase safety products for children and families, as well as offer ...

CHRISTUS Health New Mexico Region Focuses on Cost Management; Saves $1.8 Million

Region recognizes immediate, significant savings through executive leadership and team effort Dallas (Vocus) June 23, 2009 -- CHRISTUS St. Vincent Regional Medical Center and CHRISTUS St. Vincent Medical Group in Santa Fe, New Mexico, through teamwork, focused efforts ...

Oracle Focuses on Health Sciences Partner Enablement, Growth, and Accreditation

New Industry-Specific Tools and Training Aimed at Helping Partners Increase Profitability and Deliver Higher Quality, Cost Effective Solutions SAN DIEGO, June 22 /PRNewswire-FirstCall/ -- DIA 45th Annual Meeting -- News Facts To support the ongoing success and growth o...

New interdisciplinary volume focuses on advances in stem cell research

COLD SPRING HARBOR, N.Y. - In a variety of organisms, from zebrafish to fruit flies to humans, stem cells have the potential to differentiate into a variety of tissues--and, in some cases, to give rise to a complete new organism. Stem cell research, therefore, has attracted the attention of a ...

More>>

focuses in Medical Technology

Sunesis Pharmaceuticals Focuses Resources on Development of Voreloxin (Formerly SNS-595)

Development Leadership Team in Place to Advance Voreloxin to Late-Stage Trials Strategic Realignment Includes Workforce Reduction to Streamline Operations SOUTH SAN FRANCISCO, Calif., June 3 /PRNewswire-FirstCall/ -- Sunesis Pharmaceuticals, Inc. (Nasdaq: SNSS ...

New Data Focuses on Abuse of Stimulant Medication

New Data Suggests Less Abuse-Related Effects For OROS(r) Methylphenidate Two New Studies Highlight Potential Benefit of Unique OROS(r) Formulation SAN DIEGO, CA, May 22, 2007 - Stimulant drug abuse remains an ongoing concern for parents and physicians who prescribe medications to treat Attenti...

Juvenile Diabetes Research Foundation, The Genomics Institute of the Novartis Research Foundation Announce Innovative Diabetes Drug Discovery and Development Partnership

... - Program focuses on Expanding Pipeline of Drugs For People with Type 1 Diabetes - NEW YORK, Aug. 5 /PRNewswire-USNewswire/ -- The Juvenile Diabetes Research Fo...

Shire Reports Positive Results From First of Three Phase III Trials of velaglucerase alfa for Type 1 Gaucher Disease and Provides Important Updates on Interactions With FDA

...egic goal is to become the leading specialty biopharmaceutical company that focuses on meeting the needs of the specialist physician. Shire focuses its business on attention deficit hyperactivity disorder (ADHD), human gene...

FDA Issues Complete Response Letter for INTUNIV(TM) (guanfacine) Extended Release for the Treatment of ADHD in Children and Adolescents

...egic goal is to become the leading specialty biopharmaceutical company that focuses on meeting the needs of the specialist physician. Shire focuses its business on attention deficit hyperactivity disorder (ADHD), human gene...

R788 in TASKi3 Clinical Trial Does Not Meet Efficacy Endpoints in RA Patients Who Had Previously Failed Biologic Therapies - Results Incongruent

...scovers and develops novel, small molecule drugs for the treatment of inflammatory/autoimmune diseases and metabolic diseases. Our pioneering research focuses on intracellular signaling pathways and related targets that are critical to disease mechanisms. Rigel's productivity has resulted in strategic collab...
focuses in Medical Products

Alexander McQueen Eyewear Collection

Description:... The Alexander McQueen eyewear collection focuses on a distinctive sophisticated style, with feminine lines, assertive shapes and original silhouettes....
Company:Safilo Group

ALM PrismAlix® Lighting Systems

Description:... Features exclusive micro-prism refractive technology that precisely focuses a column of evenly distributed light onto the surgical site. Patented prism based technology delivers an unmatched combination of cavity illumination,...
Company:Getinge USA, Inc.

VIEW with 15 inch Monitor

Description:... to room or across town, it is completely collapsible with an adjustable height monitor allowing plenty of room for writing and task work. The camera focuses quickly and turns 360 degrees horizontally / 240 degress vertically for viewing everything from the clock on the wall across the room to your newspape...
Company:Vision Technology, Inc.

Specialty Laboratories

Description:... reference laboratory serving thousands of clients throughout the United States and internationally. Unlike standard reference laboratories, Specialty focuses on cutting-edge research and development of new assays as well as refinement of existing diagnostic tests to produce assays with greater sensitivity, ...
Company:Specialty Laboratories

AvantGuard Low Binding Barrier Tips

Description:...tip. Most other filter tips are advertised as low retention, which means the focus is on liquid not adhering to the pipet tip. However, AvantGard also focuses on low binding which reduces the binding of valuable molecules such as DNA, proteins, and enzymes which may still be retained even if all the liquid i...
Company:MIDSCI

AvantGuard Low Binding Barrier Tips, Long Reach

Description:...tip. Most other filter tips are advertised as low retention, which means the focus is on liquid not adhering to the pipet tip. However, AvantGard also focuses on low binding which reduces the binding of valuable molecules such as DNA, proteins, and enzymes which may still be retained even if all the liquid i...
Company:MIDSCI
focuses in Medical Definition

Medicine

...without referring to specialists. [ citation needed ] Geriatrics focuses on health promotion and the prevention and treatment of disease and disabil...nes of surgery , although their naming might suggest so. Urgent care focuses on delivery of unscheduled, walk-in care outside of the hospital emergency ...

Personalized medicine

...tion 6 See also 7 References 8 External links Limitations of traditional medicine Traditional diagnosis focuses on the symptoms of a patient's illness whereas a personalized medicine approach can directly examine and analyse the genetic basis of a disease and st...
focuses in Medical Dictionary

Vegetarianism

...ing the flesh of any animal, with or ... Veganism, sometimes called "strict vegetarianism ", excludes all animal products ... A vegetarian diet focuses on plants for food. These include fruits, vegetables, dried beans and ... Vegetarianism (Nemours Foundation) Return to top. Teenagers ... Informa...

Urology

... Urology is the surgical specialty that focuses on the urinary tracts of males and females, and on the reproductive system of males. Medical professionals specializing in the field of urology are ...

Tobacco

... tobacco n. , pl. -cos or -coes . Any of various plants of the genus Nicotiana, especially N. tabacum, native to tropical America and widely focuses on tobacco issues and related news, history, lawsuit, media attention, and tips for quitting smoking. Non-government initiative to protect child...

Tic

...ver, such as abdominal tensing or toe crunching. Common motor and vocal tics are, respectively, eye blinking and... Industrial contractor that focuses on general heavy industrial construction. TIC has the financial strength, resources and systems to support any size project. ... TIC is Powere...

Recovery

...on all programs and activities involved in or impacted by the Recovery Act or which ... The International Disaster Recovery Association (IDRA) focuses on the telecommunications aspects of contingency planning, emergency management, employee safety ... The Economic Recovery Payment will be p...

Protein

...s the structural material of bodily tissues. ... Protein synthesis takes place on ribosomes enormous complexes containing three ... This chapter focuses primarily on protein synthesis in prokaryotes because it ... For the Absolute Highest Quality Supplements... at the Absolute Lowest Price... Che...
focuses in Biological News

World Day to Combat Desertification focuses on human security

Human security is under threat from desertification, land degradation and drought. Combating this threat requires an integrated international response, which is why the theme for this year's World Day to Combat Desertification is 'Conserving land and water = Securing our common future'. Deserti...

Supply Chain Council Seminar Focuses on Defense and IT

Design Chain Operations Model and Convergence Theme WASHINGTON, April 8 /PRNewswire-USNewswire/ -- Supply Chain Council (SCC) will host at the Georgia Institute of Technology , the following events around the internationally used standard, the Supply Chain Operations Reference Model (SCOR): ...

Supply Chain Council Seminar Focuses on Defense and IT

Design Chain Operations Model and Convergence Theme WASHINGTON, April 8 /PRNewswire-USNewswire/ -- Supply Chain Council (SCC) will host at the Georgia Institute of Technology , the following events around the internationally used standard, the Supply Chain Operations Reference Model (SCOR): ...

New text focuses on formidable opportunistic fungus

Modern medical technologies are repairing the human body in ways never imagined only a few years ago, but they are leaving an increasing population of patients who are newly susceptible to opportunistic pathogens. Invasive and chronic fungal infections have become a formidable clinical opponent, a...

Text focuses on diagnosing infections in immunocompromised patients

Over the past twenty-five years, the number of patients with compromised immune systems has grown astronomically. High-risk patients such as these require a unique set of healthcare solutions that take into consideration everything from the etiology and degree of immune suppression to the individu...

New lab manual focuses on essential methods for purifying and characterizing proteins

COLD SPRING HARBOR, N.Y. (Oct. 7, 2008) A new, user-friendly laboratory manual for protein purification and analysis has just been released by Cold Spring Harbor Laboratory Press. Designed for routine, day-to-day use in the laboratory, it includes essential step-wise protocols as well as backg...
focuses in Biological Technology

Jivan Focuses on Solutions for Transcriptome Sequencing

LARKSPUR, Calif., April 9 /PRNewswire/ -- Jivan announced today that it will provide bioinformatics solutions for high-throughput transcriptome sequencing (RNA-Seq) and expression. Leveraging Jivan's industry-leading bioinformatics infrastructure for analysis of mRNA in biological samples, Jivan w...

ImQuest Presentation at Keystone Symposium Focuses on Advancements in Their Cancer Research and Development Program

FREDERICK, Md., April 8 /PRNewswire/ -- ImQuest Life Sciences presented their latest biological results supporting the continued development of their novel small molecule piperazine compound for the treatment of solid tumors at the Targeted Cancer Therapeutics meeting held in Whistler, British Col...

Siemens Focuses on Role-Based, Context-Sensitive, and Knowledge-Driven Solutions at HIMSS 2009

New portal enhancements and software versions offer greater efficiency in imaging IT. CHICAGO, April 1 /PRNewswire-FirstCall/ -- Siemens Healthcare ( www.siemens.com/healthcare ) will highlight workflow enhancements and demonstrate role-based portals, innovative applications,...

Clinical Research Study Focuses on Little Known Behavioral Changes Related to Parkinson's Disease

Study Recruiting Adult Parkinson's Patients with Behavioral Changes KING OF PRUSSIA, Pa., Jan. 22 /PRNewswire/ -- Parkinson's disease affects 6.3 million people worldwide. While the disease is recognized for its profound effects on movement such as tremors, less known is that 1 in 3 Par...

ECBC's Environmental BioMonitoring Laboratory Focuses on the Future

ABERDEEN PROVING GROUND, Md., Jan. 8 /PRNewswire/ -- Mindful of the tragedy of Sept. 11, 2001, and the anthrax attacks that followed, Edgewood Chemical Biological Center's (ECBC) Environmental BioMonitoring Laboratory (EBML) staff focuses on developing technologies and services that address the ne...

New Initiative Focuses on Water Quality Improvement in the Mississippi River Basin and Gulf of Mexico

ST. LOUIS, Dec. 8 /PRNewswire-FirstCall/ -- A new initiative announced today aims to reduce nutrient and sediment movement into the United States' largest river system, the Mississippi River. Monsanto is partnering with multiple agricultural and conservation groups that are working with farmers to...
focuses in Biological Products

Cell Culture Training Courses from European Collection of Cell Cultures (ECACC)

Description:...and government institutes for over seven years. We offer a Level I course designed to introduce candidates to cell culture and a Level II course which focuses on more specialist areas such as planning and management of a cell culture laboratory, primary cell culture, baculovirus and large scale cell culture....
Company:European Collection of Cell Cultures (ECACC)

Rice Oligo Microarray Kit, 22K from Agilent Technologies

Description:...esses, and biotic and abiotic stress response. Each microarray contains sequences representing estimated coverage of 60% of the rice (japonica) genome focuses on well annotated genes selected by Dr. Shoshi Kikuchi, (Japan) National Institute of Agrobiological Sciences. Kit contains 5 standard 1 x 3? gla...
Company:Agilent Technologies
focuses in Biological Definition

Biology

...structures at the level of tissues, organs and bodies; a third grouping considers organisms and their histories; a final constellation of disciplines focuses on the interactions. It is important to note, however, that these boundaries and groupings and descriptions are a simplified description of biologica...

Brain

...f brain activities. Stimulus from any source can trigger a general arousal process that decreases reliance on cortical processes, or that enhances and focuses cortical processes. Such diverse causes as hunger, fatigue, beliefs, unfamiliar information or actual threats can trigger an alert response that can...

Endosymbiont

.../service/books/10125/ An excellent review of insect endosymbionts that focuses on genetic issues. Jennifer J. Wernegreen (2002), Genome evolution in bact...n causing African sleeping sickness, which is transmitted by tsetse flies. focuses on methods using the primary and secondary endosymbionts of the tsetse fly....

Endosymbiont

.../service/books/10125/ An excellent review of insect endosymbionts that focuses on genetic issues. Jennifer J. Wernegreen (2002), Genome evolution in bact...n causing African sleeping sickness, which is transmitted by tsetse flies. focuses on methods using the primary and secondary endosymbionts of the tsetse fly....

Epigenetics

..., and was therefore (borrowing from the Greek) epigenetic. The psychologist Erik Erikson developed an epigenetic theory of human development which focuses on psycho-social crises. In Erikson's view, each individual goes through several developmental stages, the transition between each of which is marked ...

Genetics

... Molecular genetics builds upon the foundation of classical genetics but focuses on the structure and function of genes at a molecular level. Molecular...e structure and function of genes at a molecular level, ecological genetics focuses on wild populations of organisms, and attempts to collect data on the ecolo...
focuses in Biological Dictionary

Zoology

... Zoology , also spelled zoölogy, is the branch of biology that focuses on the structure, function, behavior, and evolution of animals. The zoologist's pronunciation of " zoology " is . zoology n. , pl...

Wild-type

...s, thesaurus, Word of the Day, and word games. Home. Research Blog. Personal Blog. Designing potent posters: Process, Format, ... The Wild Type focuses on the impact of design and social media on scientific ... Ouran High School Host Club, Romance/Humor, pairing: Mori & Haruhi, How did Mori get...

Variety

...d to raising funds for the purpose ... Variety's Kids. Gold Heart Program. Paper Heart Program. Golf Tournament at Robinson's Ranch ... Variety focuses on four core areas to help our kids become healthy and independent: ... Variety provides durable medical equipment, as well as developmental program...

Upstream

...... UPSTREAM ACADEMY NETWORK. EMERGING LEADERS ACADEMY. LEADERSKILLS ... Upstream Asia is a corporate and marketing communications network that focuses on Asia-Pacific markets including China, Hong Kong, Singapore, Australia and Japan Omaha brewpub, featuring Gold Coast Blonde, Honey Raspberry Ale,...

Translation

...e translator lives on the desktop and translates from English into Japanese, Italian, French, German, Spanish, and Hebrew. Translation in SIL focuses on the academic training, research, and technical ... Translation theory and practice. The ideal translation will be accurate, ... Stranslati...

Systems biology

...biology -based inter-disciplinary study field that focuses on the systematic study of complex interactions in...biology -based inter-disciplinary study field that focuses on the systematic Systems biology symposium...s biology , a field of study in the biosciences, focuses on the systematic ... Other sources consider syst...
Other TagsArterieMalaysWarneNevNevNev
(Date:11/30/2009)... In study, athletes had ,younger, immune cells tha...Y, Nov. 30 (HealthDay News) -- Studies have shown ...cancer, and now new research shows that the reason...Endurance athletes had longer telomeres -- DNA at ...n their white blood cells than healthy, nonsmoking...
(Date:11/30/2009)..., , NEW ORLEANS, Nov. 30 /PRNewswire-USNe... employees of the global corporation Sodexo will h...xo Facilities and Maintenance headquarters, 3800 D...able leave policy and arbitrary disciplinary polic...to care for an ill family member. Sodexo employees...
(Date:11/30/2009)..., , LOS ANGELES, Nov. 30 ...tino Decisions, the Robert Wood Johnson Foundation... Mexico (UNM-RWJF Center), and impreMedia, shows a...ectoral about the importance of health care reform...f coverage. For the first time, health care tops t...
(Date:11/30/2009)..., , SCHAFFHAUSEN, Switzerland, Nov. 30 /P...YSE: TYC ) today announced that its 2010 annual ...dnesday, March 10, 2010 at 3:00 p.m. Central Europ...-Strasse 21, 8002 Zurich, Switzerland. Registered ...te) will be entitled to vote at the annual general...
(Date:11/30/2009)..., , GAINESVILLE, Fla., Nov. 30 /PRNewswire...DynaCAD marks the availability of the first FDA-cl...e detection and analysis by a radiologist of suspi...icially unveiled at the Radiological Society of No...Developed in partnership with leading experts in b...
Breaking Medicine News(10 mins):Health News:Exercise Guards White Blood Cells Against Aging 2Health News:Exercise Guards White Blood Cells Against Aging 3Health News:As H1NI Hits New Orleans in Force: School Custodians to Hold Rally to Call on Contractor to Stop Penalizing Workers Coping With Illness 2Health News:New Survey Shows Overwhelming Support Among Latinos for Health Care Reform That Includes Public Option 2Health News:New Survey Shows Overwhelming Support Among Latinos for Health Care Reform That Includes Public Option 3Health News:New Survey Shows Overwhelming Support Among Latinos for Health Care Reform That Includes Public Option 4Health News:New Survey Shows Overwhelming Support Among Latinos for Health Care Reform That Includes Public Option 5Health News:New Survey Shows Overwhelming Support Among Latinos for Health Care Reform That Includes Public Option 6Health News:New Survey Shows Overwhelming Support Among Latinos for Health Care Reform That Includes Public Option 7Health News:New Survey Shows Overwhelming Support Among Latinos for Health Care Reform That Includes Public Option 8Health News:New Survey Shows Overwhelming Support Among Latinos for Health Care Reform That Includes Public Option 9Health News:New Breast MRI Technology Enables Enhanced Breast Cancer Detection 2Health News:New Breast MRI Technology Enables Enhanced Breast Cancer Detection 3
(Date:11/30/2009)...ratures continue to rise scientists are presented ...ecies respond and adapt. In a paper published in ...odriguez-Trelles and Dr Miguel Rodriguez assess th... of approximately 0.6˚C has already affected ...ng ecologists and evolutionary biologists is to pr...
(Date:11/30/2009)...report published in the December 2009 print issue ...lar type of control over their fertility that wome...sts have found how and where androgenic hormones w...on and male fertility. This opens a promising aven...discovery also offers hope to those who cannot hav...
(Date:11/26/2009)...r impressive antlers, red deer have been caught in... antlers are much more than decorative. They are l...ing. John Currey, from The University of York, UK,...f bone for over half a century and has become fasc...ugh a long-standing collaboration with Tomas Lande...
Breaking Biology News(10 mins):How can scientists measure evolutionary responses to climate change? 2Tough yet stiff deer antler is materials scientist's dream 2Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 1Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 2Hologic to Present at the 29th Annual Canaccord Adams Global Growth Conference 51475 1Hush little baby Linking genes brain and behavior in children 9237 1Hush little baby Linking genes brain and behavior in children 9237 2
Other Contentsridgeridgemicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadaches