Navigation Links


Countries in Medical News

Brazil proves developing countries can use generic medicines to fight HIV/AIDS epidemic

PROVIDENCE, R.I. [Brown University] Brazil's nearly two-decade effort to treat people living with HIV and AIDS shows that developing countries can successfully combat the epidemic. Inexpensive generic medicines are a large part of the solution, say researchers from Brown University and the Harvar...

Research output in developing countries reveals 194 percent increase in five years

London, 2 July 2009 The partners of Research4Life announced today at the World Conference of Science Journalists 2009 that a new research impact analysis has demonstrated a dramatic rise in research output by scientists in the developing world since 2002. By comparing absolute growth in published...

Thomson Reuters Partners with Research4Life to Bring Scientific Research Information Resources to Developing Countries Around the World

Healthcare & Science Business Creates Special Edition of ISI Web of Knowledge To Advance Research4Life Partnership PHILADELPHIA and LONDON, June 16 /PRNewswire/ -- The Healthcare & Science business of Thomson Reuters today announced that it is joining Research4Life to provide the deve...

RA individuals from lower GDP countries keep working despite worse symptoms than richer countries

Copenhagen, Denmark, Friday 12 June 2009: Individuals diagnosed with rheumatoid arthritis (RA) in lower gross domestic product (GDP) countries (GDP below $11,000) are more likely to continue working despite higher disease activity and functional disability scores compared to their counterparts in ...

Conflict-affected countries receive less aid dedicated to reproductive health

Low income, conflict-affected countries such as Afghanistan, Sudan and Somalia receive less development money for reproductive health than countries that are not experiencing conflict, according to a new study in this week's PLoS Medicine . United Nations indicators show that countries affect...

Physicians for Human Rights and 20 Countries Demand Iran Release AIDS Doctors

A Nobel Peace Prize laureate organization and a coalition of health and human rights activists held simultaneous events in New York, Washington, DC, and 20 countries on Tuesday to call for the release of two Iranian physicians imprisoned since June. New York, NY (PRWEB)...

More>>

Countries in Medical Technology

First Published Study of New HPV Test for Developing Countries Shows High Accuracy in Predicting Cervical Disease

QIAGEN's careHPV test provides 'substantially more accurate' front-line screening VENLO, Netherlands, Sept. 21 /PRNewswire-FirstCall/ -- A new HPV test developed by QIAGEN specifically for use in regions of the world with scarce resources is "substantially" more a...

Wyeth Applauds Six Countries Across Europe, and the Middle East, That Recently Announced the Inclusion of the 7-Valent Pneumococcal Conjugate Vaccine (PCV7) in Their Immunization Schedules

MAIDENHEAD, England, July 8 /PRNewswire-FirstCall/ -- - PREVENAR Vaccine to Help Protect Children Against the Leading Vaccine-Preventable Cause of Death in Young Children Wyeth applauds the countries of Cyprus, Hungary, the Kingdom of Bahrain, Republic of Ireland, Slovak Republic and Swede...

New Analysis from 14 Countries Identifies Drug Access Priorities to Achieve 2010 AIDS Treatment Target

Dr. Jim Kim joins teleconference to release report with ITPC. Kim says foundations laid by AIDS response are "the best chance we've ever had to build comprehensive health systems in the poorest settings." NEW YORK AND CAPE TOWN, South Africa, Nov.27 /PRNewswire-USNewswire/ -- The Internati...

Salvacyl(R), Developed by Debiopharm, is Launched in two European Countries

LAUSANNE, Switzerland, June 23 /PRNewswire/ -- Debiopharm Group (Debiopharm), a Swiss-based global biopharmaceutical group of companies with a focus on the development of prescription drugs that target unmet medical needs, announced that Salvacyl(R) (also known under the trade names Moapar(R) ...

Simbionix and Johnson & Johnson LLC Announce Distribution Agreement at Russia and the CIS Countries

CLEVELAND, Ohio, April 16 /PRNewswire/ -- Simbionix, the world's leading developer of medical simulation systems, today announced an agreement with Johnson & Johnson LLC for distribution of Simbionix's simulators and related products. Johnson & Johnson, LLC operates in Russia, U...

amfAR Announces Funding for HIV Services and Research Aimed at Men Who Have Sex With Men in Developing Countries

More Than 100 Groups Apply for Grants to Assist Men Who Have Sex With Men in Developing Countries NEW YORK, Feb. 21 /PRNewswire-USNewswire/ -- In an ambitious move to significantly bolster global HIV program efforts targeting populations especially vulnerable to HIV, amfAR, The Foundation...
Countries in Medical Products

Biotrace Sterile Barium Sulfate USP

Description:..., single use vial. CE Mark approval from the European Union has enabled Biotrace to pioneer the global markets and to be freely distributed in all the countries of the European Economic Area (EEA) and Israel. International reputation has rapidly made Biotrace the most recommended bone cement radiopacifier in t...
Company:Bryan Corporation

Harms Trabeculotomy Probe, left

Description:.... Katena offers its products to over 7,000 customers in the United States and, through a global network of distributors, to customers in more than 100 countries around the world....
Company:Katena Products, Inc.

Harms Trabeculotomy Probe, right

Description:.... Katena offers its products to over 7,000 customers in the United States and, through a global network of distributors, to customers in more than 100 countries around the world....
Company:Katena Products, Inc.

BN ProSpec System

Description:...N ProSpec, the system of choice for customers performing routine and specialty Plasma Protein assays in medium throughput laboratories in more than 50 countries worldwide has achieved a new milestone. Dade Behring is pleased to announce the placement of the 1000th BN ProSpec system. The customer centere...
Company:Dade Behring, Inc.

MAGNEVIST

Description:... contrast agent for use in MRI. Today, the product is still a market leader with indications in CNS, head, neck and body. MAGNEVIST is used in over 85 countries and has established a positive clinical experience in more than 30 million patients worldwide. Clinical studies are also being pursued in vasculature ...
Company:Abbott Diagnostics

Bioglue

Description:...f purified bovine serum albumin (BSA) and glutaraldehyde. The BSA is obtained from cattle exclusively from bovine spongiform encephalopathy (BSE) free countries and undergoes processing that reduces or inactivates viruses. The solutions are dispensed by a controlled delivery system, composed of a reusable deli...
Company:Cryolife, Inc.
Countries in Medical Definition

Biomedicine

...d clinical setting. The programmes usually encompass the medicine master's examina , which might however differ in extent and depth between different countries and/or faculties. A person who has finished the programme or is active in the field of biomedicine is usually referred to as a medical researcher or...

Cachexia

...er cachexia". It was also prevalent in AIDS patients before the advent of triple-therapy for that condition; now it is seen less frequently in those countries where such treatment is available. In those patients who have Congestive Heart Failure , there is also a cachectic syndrome. Also, a cachexia co-morb...

European Prospective Investigation into Cancer and Nutrition

...nalyses are focusing particularly on stomach , colorectal , breast , prostate and lung cancers. The different dietary patterns in the different countries should enable reliable associations to be made between particular diets and cancers. The analysis of stored blood samples should also allow dissection...

Pathology

...ists are medical doctors registered with the UK General Medical Council . They will have completed an undergraduate medical education which in most countries lasts 4-6 years. The training to become a pathologist is under the oversight of the Royal College of Pathologists . Typically a one year training att...

Medicine

...of people formally trained and authorized to apply medical knowledge. Many countries and legal jurisdictions have legal limitations on who may practice medic...sts. Aside from tribal cultures, the most significant divide in developed countries is between universal health care and market-based health care (such as ...

Personalized medicine

...care, or is it short term? New policies and procedures will be necessary. countries such as the United States are currently struggling with the burgeoning of h...urgeoning science into use. The difficulty is that medical education in all countries does not provide adequate genetic instruction. A small number of universi...
Countries in Medical Dictionary

Yellow Fever

...ease. It is transmitted by the bite of mosquitoes . Yellow fever is an important cause of hemorrhagic illness in many African and South American countries despite existence of an effective... The disease is caused by the yellow fever virus, which belongs to the flavivirus ... Yellow fever i...

Trypanosomiasis

...veral diseases in vertebrates caused by parasitic protozoan trypanosomes of the genus Trypanosoma. More than 66 million women, men, and children in 36 countries of... Human African trypanosomiasis , Sleeping sickness, African lethargy, or Congo trypanosomiasis is a parasitic disease of people and anim...

Tooth decay

...xt to the pulp, the pulp may not be strong enough to ... DIRECTORY: FAN > Health > Teeth > Caries > Tooth Decay Trends in F vs. NF countries ... "Graphs of tooth decay trends for 12 year olds in 24 countries, prepared using ... tooth decay remains the single most common chronic...

Terrorism

...t Terrorism -- pulls together all aspects undertaken ... Countering Terrorism on the Economic Front ... annual report on terrorism for those countries and groups meeting the criteria of the Act. ... ...

Sugar

...different processes, most of which ... The major cane sugar producing countries are countries with warm climates, such ... The greatest quantity of sugar is produced i...

Stomach cancer

...her resources. ... though it has spread to other organs, it is still called stomach cancer . ... Stomach cancer is much more common in some countries other than the United States. ... Stomach Cancer | Cancer .Net - The American Society of Clinical Oncology (ASCO) is the world's leading prof...
Countries in Biological News

HPV DNA test identifies cervical pre-cancerous disease in developing countries with 90% success rate

Results of the first study to determine the accuracy of a new rapid screening test for HPV (Human Papilloma Virus), created specifically for use in the developing world, have shown it to be 90 per cent accurate in detecting precancerous cervical disease when tested on a group of local women in Sha...

Early cessation of breastfeeding by HIV+ women in poor countries and child survival

July 24, 2008 A new study by researchers from Columbia University's Mailman School of Public Health addresses one of the most challenging issues in infant health and preventing mother-to-child HIV transmission in poor countries. In these settings, HIV-infected mothers had been advised that for t...

Conservation of freshwater fish biodiversity: a challenge for the countries of the South

Humans have regularly been introducing exotic species into natural environments in order to provide for their nutritional necessities or meet less indispensable purposes such as horticulture, fishing or hunting. However, the particular environments are not always adapted for hosting new arrivals. ...

Sanitation investment in poor countries would yield $9-to-1 benefits in productivity, health: UN

Experts estimate that $9 in productivity, health and other benefits are returned for every dollar invested installing toilets for people in countries that today are off-track in meeting the UN Millennium Development Goal (MDG) for sanitation. Some argue that meeting the sanitation MDG is also...

Data on life expectancy show many countries clustered in high mortality traps

Boston, MA -- Growing recognition of the importance of health as a contributing factor to economic development and societal change has prompted the Proceedings of the National Academy of Sciences (PNAS) to add a new subsection in Sustainable Health to its existing section on Sustainable Developmen...

M2SYS Partners With Gnosis Medical Services to Provide Accurate Patient Identification in Developing Countries Through Innovative Biometrics Solution

Biometric Fingerprint Technology used to Identify Patients and Retrieve Crucial Medical Records ATLANTA, Aug. 28 /PRNewswire/ -- M2SYS Technology, an award-winning biometric technology research and development firm, announced today that they have partnered with Gnosis Me...
Countries in Biological Technology

Health Care Innovations and Opportunities Attract Attendees from 40 Countries and Delegations from 12 to 6th Annual World Health Care Congress

China, India, Israel, many more to attend global event for health care leaders in businesses, government, April 14-16, 2009, Washington , D.C. WASHINGTON, March 31 /PRNewswire/ -- The 6th Annual World Health Care Congress, April 14-16, Washington, D.C., is pleased to announce sev...

Health Robotics Expands i.v.STATION(TM) Partnership With Can-Med in 10 Countries Within Central Asia

BOZEN, Italy, February 23 /PRNewswire/ -- Health Robotics and Can-Med today announced that they have signed a definitive agreement whereby Can-Med has acquired the exclusive distribution rights to Health Robotics' i.v.STATION robot in Armenia, Georgia, Kazakhstan, Uzbekistan, Azerbaijan, Iran,...

As personalized, genomic medicine takes off, four developing countries show the way for others

Developing countries that want the benefits of cutting-edge health care possibilities based on the genetic variation of individual citizens and sub-populations need to foster the new science at home, says a major new Canadian study published today by Nature Publishing Group. In a special six-p...

Most developing countries ill-equipped to ensure global biosafety: UN University

A two-year UN study of internationally funded training programmes in biotechnology and biosafety warns that as many as 100 developing countries are unprepared to effectively manage and monitor the use of modern biotechnologies, leaving the world community open to serious biosafety threats. The ...

Most developing countries ill-equipped to ensure global biosafety: UN University

A two-year UN study of internationally funded training programmes in biotechnology and biosafety warns that as many as 100 developing countries are unprepared to effectively manage and monitor the use of modern biotechnologies, leaving the world community open to serious biosafety threats. The ...

European Union has 'Three-Speed' Healthcare System - Many Countries Lagging in Reform

BRUSSELS, October 1 /PRNewswire/ -- Austria now has the most consumer-friendly healthcare system in Europe, according to the 2007 Euro Health Consumer Index (EHCI). The EHCI compares all the EU 27 national healthcare systems, along with Norway and Switzerland, from a consumer-friendly point of...
Countries in Biological Definition

Antibiotic

...ed instruments) revolutionized medicine . It has been said that this is the greatest advance in health since modern sanitation . People in developed countries now find it hard to imagine that a simple scratch once always carried the risk of infection and death. See also Timeline of antibiotics . Cl...

Avian influenza

...anuary 2004 , a major new outbreak of H5N1 avian influenza surfaced in Vietnam and Thailand 's poultry industry, and within weeks spread to ten countries and regions in Asia , including Indonesia , South Korea , Japan and mainland China . Intensive efforts were undertaken to slaughter chickens ,...

Biodiversity

...on on Biological Diversity. The parties to this convention include all the countries on Earth with the exception of Andorra, Brunei Darussalam, the Holy See, I...through the notion of resource and innovation. The new agreements commit countries to conserve the biodiversity , develop resources for sustainability and...

Blood

...er traumatic or not (e.g. during surgery), as well as certain blood diseases like anemia and thalassemia , can require blood transfusion . Several countries have blood banks to fill the demand for transfusable blood. A person receiving a blood transfusion must have a blood type compatible with that of ...

Culture

...st of cultures 4.1 Cultures of contemporary countries 4.2 Contemporary local cultures 4.3 Other co...with " nature ". According to this thinking, some countries are more civilized than others, and some people ar... List of cultures Cultures of contemporary countries Main article: List of national culture article...

Diabetes mellitus

...xpected to occur in Asia and Africa, where most of the diabetic patients will be seen by 2025. The increase in incidence of diabetes in the developing countries follows the trend of urbanisation and life style changes. Diabetes is in the top 10, and perhaps the top 5, of the most significant diseases in the...
Countries in Biological Dictionary

Yellow fever

... disease. It is transmitted by the bite of mosquitoes . Yellow fever is an important cause of hemorrhagic illness in many African and South American countries despite existence of an effective... The disease is caused by the yellow fever virus, which belongs to the flavivirus ... Yellow fever is d...

Starch

...o fractions--amylose and amylopectin. ... Starch Coil or Spiral Structure: ... Starch - Amylopectin - Chime in new window ... Cassava-producing countries should turn more of that relatively low-cost raw material into high-value starch for domestic and international markets Starch , common name app...

Primitive streak

...mitive Streak was essentially a gift from my sister Kate, at a time when I ... A double award-winning project, Primitive Streak has toured in 7 countries since ... Primitive streak synonyms, Primitive streak antonyms. Information about Primitive streak ... Primitive streak . Also found...

Population

...uced by statistical means,... This is a list of countries ordered according to population . The list includ... Britain remains highly conjectural ... List of countries by population See also: List of countries by past and future population , List of...

Phage

... therapeutic use of bacteriophages to treat pathogenic bacterial infections. Although extensively used and developed mainly in former Soviet Union countries for about 90 years, this method of therapy is... Welcome to Phage Biotechnology Corp., A manufacturer of protein pharmaceuticals for human us...

Moneran

..... Encyclopeadia articles concerning Moneran and Protistan. ... Australia, New Zealand, and the Pacific ... Britain, Ireland, France, and the Low countries ... Encyclopedia: Moneran and Protistan - Encyclopeadia articles concerning Moneran and Protistan. See more Encyclopedia articles on: Moneran ...
Other TagsScansShinglesBorderInterventionStillStillStillStillPortionOther Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircular