Navigation Links


Cooling in Medical News

Nationwide Heat Wave Finally Gives Way To Cooling Trend

Metromint Gives Consumers Six Ways to Chill Out This Summer SAN FRANCISCO, July 2 /PRNewswire/ -- A nationwide cooling trend is forecasted to arrive today in the form of Metromint ( www.metromint.com ), the all-natural mintwater that combines pure water and real mint. Metromint provides a ...

Keep Safety in Mind While Cooling Off in the Water

Youngsters need extra vigilance near pools, beaches and hot tubs, experts warn SUNDAY, June 14 (HealthDay News) -- Summertime brings pool parties, lazy days at the beach and boating trips to the lake. All that time in and around water also brings a heightened risk of drowning, acco...

Chill Cooling Towels Introduces Instant Relief for Hot Flashes and Night Sweats

CHILL International, Inc. announces the launch of a new menopausal cooling towel , which provides instant relief for hot flashes and night sweats. Key West, FL (Vocus) April 23, 2009 -- CHILL International, Inc. announces the launch of a new menopausal cooling towel...

St. Joseph's Healthcare System Becomes First Hospital in the Region to Implement Pre-Hospital Therapeutic Cooling to Save the Lives of Cardiac Arrest Patients

PATERSON, N.J., April 15 /PRNewswire/ -- An estimated 1,000 lives could be saved each year if heart attack patients received faster emergency care during and immediately after a heart attack. Recognizing that each minute lost could mean the difference between saving a life ... and losing it, Mobil...

Top Neurology Programs Control Fever with Arctic Sun Cooling Technology

Medivance's safe temperature management technology, aggressive fever control may improve neurologic outcomes after stroke or brain injury LOUISVILLE, Colo., March 25 /PRNewswire/ -- The nation's top-rated neurology programs cool their critically ill stroke and brain injured patients with the ...

Cardium Reports on New York City's Adoption of Therapeutic Cooling Protocols for Cardiac Arrest Patients

SAN DIEGO, Dec. 5 /PRNewswire-FirstCall/ -- Cardium Therapeutics (NYSE Alternext: CXM) and its operating unit InnerCool Therapies today reported on New York City's adoption of procedures designed to promote temperature modulation therapy for cardiac arrest patients, as featured in an article in Th...

More>>

Cooling in Medical Technology

Cardium's InnerCool Announces Positive Benefits of Cooling During Robotic-Assisted Prostate Surgery Published in Urology

SAN DIEGO, March 9 /PRNewswire-FirstCall/ -- Cardium Therapeutics (NYSE Alternext US: CXM) and its operating unit InnerCool Therapies, Inc., today reported that positive clinical findings demonstrating faster recovery of urinary continence using localized manual cooling techniques during robotic-a...

Treatment Shows Excellent Results for Providence Tarzana Patients Following Cardiac Arrest

...fact, one recommendation involves working with paramedics to apply hypothermia treatment en route to hospitals, Dr. Brewster said. "We've done cooling measures for quite a long time, but there's never been a concerted effort to go hospital-wide with the process so that anyone who has a cardiac arrest...

July 2009 Mayo Clinic Women's HealthSource Highlights Food Storage Safety, Energy Therapies and Vitamins and Minerals

...tovers should be used or frozen within three to five days. Don't crowd. A refrigerator that is too full blocks air circulation, hampering the cooling process. Know when to toss. An opened package of luncheon meat can be safely stored in the refrigerator three to five days. Unopened, it will...

RISPERDAL(R) CONSTA(R) (Risperidone) Long-Acting Treatment Delayed the Time to Relapse in Patients with Bipolar I Disorder

...dministering RISPERDAL (R) CONSTA (R) to a nursing woman. RISPERDAL (R) CONSTA (R) may make you more sensitive to heat. You may have trouble cooling off, or be more likely to become dehydrated, so take care when exercising or when doing things that make you warm. Some medications interact...

Pelleve Receives FDA Clearance for the Treatment of Mild to Moderate Facial Wrinkles

...e was performed in an ambulatory (outpatient) setting with no need for skin cooling products or anesthesia and took an average of 15 to 20 minutes, depending o...nited States. Because this unique technology does not require anesthesia or cooling of the skin during the procedure, the physician can safely achieve the look...

Johnson & Johnson Pharmaceutical Research & Development, L.L.C. Announces FDA Filings for Paliperidone Palmitate and INVEGA(R)

...s and motor skills; use caution until the effect of paliperidone is known. Paliperidone may make you more sensitive to heat. You may have trouble cooling off, or be more likely to become dehydrated, so take care when exercising or when doing things that make you warm. Paliperidone should be swallo...
Cooling in Medical Products

Trans-Blot System with Plate Electrodes and Super Cooling Coil 100/120 V

Description: Includes PowerPac 200 power supply. Flexibility for a Range of Parameters. Quantitative Transfers. Native Enzyme, High Intensity, or Overnight Transfers. Faster, Higher-Efficiency Transfers via Plate Electrodes. High Field-Intensity Transfers with Movable Electrodes. Simple Assembly with Color...
Company:Bio-Rad Lab Equipment

Trans-Blot Cell with Plate Electrodes and Super Cooling Coil

Description: Includes: 2 gel holder cassettes, cell with lid and power cables, fiber pads, blot absorbent paper (15 x 20 cm). The Trans-Blot transfer cell, used with the PowerPac 200 power supply, performs efficient, high-intensity electrophoretic transfers. The Trans-Blot cell offers many advantages....
Company:Bio-Rad Lab Equipment

SurgiCool surgeon cooling system

Description: Our SurgiCool surgeon cooling system has been developed utilizing all the expertise gained in high performance motorsports. Our cool suit is simple to use and provides powerful cooling from ice water circulated through an extensive network of capillary tubing. Systems can support from one to eight...
Company:Climatech Safety, Inc.

Surgeon Cooling System

Description: Studies have shown that the best, least expensive way to prevent hypothermia in patients is to warm the OR to 72-75 degrees, eliminating the need for patient warming devices. The warm operating room, though, can cause the surgical team some heat discomfort. The Cool Vest cooling system can help kee...
Company:Shafer Enterprises LLC

Maxi-Therm® Lite Single-Patient Use

Description:... The Maxi-Therm® lite hyper-hypothermia water blankets from Cincinnati Sub-Zero take conductive warming and cooling therapy to a new, softer level. These blankets are soft, lightweight, and remain pliable at their coldest temperatures....
Company:Cincinnati Sub-Zero

PROTEAN Plus Dodeca Cell, 100-120 V

Description:...pacity of first-dimension runs in the PROTEAN IEF system, for high-throughput 2-D applications* in a convenient format. The PROTEAN Plus Dodeca cell's cooling and recirculating capabilities, along with its plate electrodes, allow consistent, high-resolution results. The handcasting system includes the PROTEA...
Company:Bio-Rad Lab Equipment

More>>

Cooling in Medical Dictionary

Yawning

...ophysiology, pathology, phylogenesis, history, yawning contagiosiness, beliefs ... Dopamine agonist-induced yawning in rats: a dopamine D3 ... cooling Diminish the Incidence of Contagious Yawning ... In humans, yawning begins in utero by 20 ... Yawning is commonly ... Online Medical Diction...

Ventricle

...elated Health Problems ... Double outlet left ventricle . Q20.3. Discordant ventriculoarterial connection ... ... both cardioplegia and topical cooling frequently orientate to the left ventricle . ... is applied around the left ventricle and into the left portion of ... Functional importa...

Traction

... with its network of more than ... e-Traction, the global marketing entity for practical and inovative electric traction solutions. ... improved cooling of TheWheel™ SM500/2FE traction systems ... Traction devices have been around for years. ... When it comes to a streetable traction device w...

Skin discoloration

... Skin discoloration results from several factors. Some are natural, such as birthmarks. ... Skin cooling After Laser Treatment Could Leave Marks. Researchers ... ... 22 disease causes of Skin discoloration , patient stories, diagnostic guides, .....

Neck X

...hirts Large Sizes. Mens Dress Shirts French Cuff and Designer French Cuff ... XXXL (19" - 19½" Neck x 36/37" Sleeve) ... Shop for Neck F/ x cooling Bandana and Golfing Accessories at Shop.com. KEEP COOL IN THE HEAT Keeps you cool and soothes aching muscles during work or play. Simply... Find G...

Migraine headaches

...'s headache , and cephalalgia or ... Headache Facts plus the Latest News on Headache Treatments - HealthNewsflash ... Migraine Ice Forehead cooling Headache Pads $5.27 BUY NOW! ... ...
Cooling in Biological News

Cantabrian cornice has experienced seven cooling and warming phases over past 41,000 years

In 1996, an international team of scientists led by the University of Zaragoza (UNIZAR) started to carry out a paleontological survey in the cave of El Mirn. Since then they have focused on analysing the fossil remains of the bones and teeth of small vertebrates that lived in the Cantabrian region...

CO2 drop and global cooling caused Antarctic glacier to form

New Haven, Conn. Global climate rapidly shifted from a relatively ice-free world to one with massive ice sheets on Antarctica about 34 million years ago. What happened? What changed? A team of scientists led by Yale geologists offers a new perspective on the nature of changing climatic condition...

Decline of carbon-dioxide-gobbling plankton coincided with ancient global cooling

ITHACA, N.Y. The evolutionary history of diatoms -- abundant oceanic plankton that remove billions of tons of carbon dioxide from the air each year -- needs to be rewritten, according to a new Cornell study. The findings suggest that after a sudden rise in species numbers, diatoms abruptly declin...

Even a little cooling helps after cardiac arrest

Is that salt marsh healthy? To answer this, Sea Grant biologists are cracking open common marsh snails and counting parasitic worms. Their claim: the more parasites, the healthier the marsh. While the parasite hypothesis may conflict with conventional ideas about infectious disease and human heal...

Tropical Atlantic cooling and African deforestation correlate to drought, report scientists

Against the backdrop of the Montreal Summit on global climate being held this week, an article on African droughts and monsoons, by a University of California, Santa Barbara scientist and others, which appears in the December issue of the journal Geology, underlines concern about the effects of glo...

August 2009 Geology and GSA Today media highlights

...xpansion offshore West Africa: Evidence for global cooling precursor events S. Kender et al., British Geolo..., may shed light on the events preceding the major cooling at 14 million years ago. The results of Kender et ...Columbia River volcanism likely triggered climatic cooling by sulphuric acid-induced volcanic winters, which ...
Cooling in Biological Technology

International Robotic Urology Symposium Reports on Benefits of Cooling During Robotic-Assisted Prostate Surgery and Introduces InnerCool's New Investigational UroCool System

SAN DIEGO, Jan. 14 /PRNewswire-FirstCall/ -- Cardium Therapeutics (NYSE Alternext US: CXM) and its operating unit InnerCool Therapies, Inc., today announced that Thomas E. Ahlering, M.D., Professor and Vice Chair of the Department of Urology at the University of California, Irvine , and a pioneer...

Cardium Reports on Science Channel Series Featuring InnerCool's Endovascular Cooling During Brain Surgery at Stanford University

SAN DIEGO, April 29 /PRNewswire-FirstCall/ -- Cardium Therapeutics (Amex: CXM ) and its operating unit InnerCool Therapies announced today that InnerCool's endovascular Celsius Control System was featured on Science Channel's "Cool Stuff: How It Works." The segment (episode 5) aired April 25,...

'Radio wave cooling' offers new twist on laser cooling

Visible and ultraviolet laser light has been used for years to cool trapped atomsand more recently larger objectsby reducing the extent of their thermal motion. Now, applying a different form of radiation for a similar purpose, physicists at the National Institute of Standards and Technology (NIST...

SENOMYX ANNOUNCES CORPORATE UPDATE AND SECOND QUARTER 2009 FINANCIAL RESULTS

...al of the Cool Flavor Program is to identify novel cooling flavors that do not have the limitations of curren...hroughput assay designed to identify potential new cooling agents. Samples that are active in the assay will be evaluated in taste tests to determine their cooling taste effect. Financial Review: ...

Rapid heating prepares energy-saving zeolite for greater role in industrial separations

...ating the membranes from room temperature to 700 degrees Centigrade in one minute, maintaining this temperature for up to two minutes and then quickly cooling it, the researchers say they have been able to eliminate the formation of grain boundary defects that undermine the sieve-like quality of zeolite's un...

SENOMYX AND FIRMENICH TO COLLABORATE ON DISCOVERY, DEVELOPMENT AND WORLDWIDE COMMERCIALIZATION OF NOVEL SWEET ENHANCERS

...for novel flavor ingredients intended to provide a cooling taste effect. The collaboration aims to identify novel cooling flavors that do not have the limitations of curren...ngredients in the savory, sweet, salt, bitter, and cooling areas. Senomyx has entered into product discovery...
Cooling in Biological Products

Super Cooling Coil, Trans-Blot cell from Bio-Rad

Description: The super cooling coil, Trans-Blot cell, provides temperature regulation for native enzyme, high-intensity, and extended electrophoretic transfer (blotting) applications performed with the Trans-Blot cell. Use of the super cooling coil requires connection to an external water recirculator, which is...
Company:Bio-Rad

SpotLight CISH Hybridizer (120 VAC, 50-60 Hz) from Invitrogen

Description:...mmable protocols 3 operating modes (Denaturation/Hybridization, Hybridization only, and Fixed temperature) Rapid temperature ramp-up from 37 - 95C and cooling from 79 - 37C Uniform temperature for all positions (+/- 1C) Optional humidity control Solid membrane numeric keypad facilitates cleaning Consistent s...
Company:Invitrogen

Eppendorf ThermoStat Plus, without block from Eppendorf North America

Description:...ntrols the temperature at your lab bench. This compact benchtop thermostat maintains different temperature levels up to 99 C*, with the "plus" being a cooling feature for temperatures as low as 5 C. The thermoblocks for 0.2 ml**, 0.5 ml, 1.0 ml, 2.0 ml tubes, and microplates enable a high degree of flexibili...
Company:Eppendorf North America

DeCypher Biocomputing Solutions from TimeLogic, a Brand of Active Motif, Inc.

Description:...risons with Smith-Waterman Packing server farm-level performance into a single server, DeCypher delivers tremendous savings in maintenance, power and cooling costs. This makes it the most cost-effective solution available for your bioinformatics discovery. Contact TimeLogic today to schedule a free, custom ...
Company:TimeLogic, a Brand of Active Motif, Inc.

Mini-PROTEAN 3 Dodeca Cell With Multi-Casting Chamber from Bio-Rad

Description:...ormat handcast (8.3 x 7.3 cm) or precast (8.6 x 6.8 cm) gels. The cell requires 3.4-4.4 L of buffer and includes an electrophoresis tank with built-in cooling coil that attaches to an external refrigerated circulator (not included), lid with power cables, 6 electrophoresis clamping frames, 2 buffer dams, dra...
Company:Bio-Rad

Mini Trans-Blot and PowerPac Basic Power Supply from Bio-Rad

Description:...gels to membranes. The Mini Trans-Blot cell accommodates two 7.5 x 10 cm gels and includes 2 gel holder cassettes, modular electrode assembly, Bio-Ice cooling unit, buffer tank, lid with power cables, and 4 fiber pads. The PowerPac basic power supply, 100-120 and 220-240 V, provides output of 10-300 V, 4-400...
Company:Bio-Rad
Cooling in Biological Definition

Brain

...fering views on the function of the brain. Hippocrates believed the brain to be the seat of intelligence, but Aristotle held that the brain was a cooling mechanism for the blood , while the heart was the seat of intelligence. Aristotle reasoned that humans are more rational than the beasts because t...

Thermoregulation

...face of your skin. evaporation - evaporative cooling occurs when water (often from perspiration) leaves...surface as a gas, lowering the body temperature by cooling blood vessels in the dermis. radiation - e.g. ...during the day and being nocturnal evaporative cooling by perspiration and panting storing fat reserv...
Cooling in Biological Dictionary

Thermoregulation

...ers and researchers dedicated to the study ... Behavioral mechanisms of thermoregulation . ... BASICS OF THERMOREGULATION . DIALOGUE WITH MYSELF. cooling THE BRAIN AND SPINE ... in our thermoregulation primer, there is ... THERMOREGULATION ––THE SCIENCE ... An introduction to the biology of the...

Polar body

...ody temperature? Read answer... Polar body cooling vests, MS cooling vests, cooling neck wraps,...

Mantle

...between the outer crust and the core. ... Mantle (geology) - Wikipedia, the free encyclopedia ... Convection in the Earth's mantle is driven by cooling from the surface, not heating from below, and is unlikely to involve thermal plumes from the deep mantle . HBO's Special Event page for Mantle ...

Graafian follicle

... The cells that form the graafian follicle are arranged in a layer three ... Graafian follicles ( 5–6 mm diameter) and recent ovula ... of cooling for exposed Graafian follicles strongly suggested ... on pig Graafian follicles of 8–10 ... Zoology information, history, articles and resear...

Carrier

...other molecule ... Carrier supplies HVAC products, HVAC Service, HVAC systems, HVAC software, and HVAC training for your commercial heating and cooling needs CARRIER , a 10-part series filmed aboard the USS Nimitz, is a character-driven, ... Use | PBS Privacy Policy. An Icon Productions and Carri...

Anneal

... ... For other uses, see annealing . Annealing is a process of slowly cooling ... Annealing · Chemical vapor deposition · Glass batch calculation · Gla...-neals . v.tr. To subject (glass or metal) to a process of heating and slow cooling in order to toughen and An·neal·ing n. 1. The process used to render g...
Other TagsArterieMalaysWarneNevNevNev
(Date:11/30/2009)...30 At a briefing of the...and the Consortium for Citizens with Disabilities ...ic Policy and Advocacy for NCOA, called on Congres...sponds to the growing crisis in long-term care for...ns of seniors, after working hard all their lives,...
(Date:11/30/2009)...mic is far from over. Every year, almost three mi...lion die from AIDS-related diseases." ,, WASHI... AIDS Day 2009 the Global AIDS Alliance (GAA) call...n two recent alarming reports from the World Healt...c continues to be of catastrophic proportion, affe...
(Date:11/30/2009)...g significant impact, CBO analysis understates the...ewswire/ -- The Blue Cross and Blue Shield Assoc...rding the estimate released today by the Congressi...irmed what many economists, actuaries, and health ...lthcare reform bill would make coverage more expen...
(Date:11/30/2009)...s equivalent to 113 chest X-rays, study finds , ... than half of patients who have abdominal/pelvic C...ts that expose them to extra radiation, U.S. resea...d pelvic series were performed on 500 patients age...30 to 50 years of age. The researchers concluded t...
(Date:11/30/2009)... 30 SEIU Local 21LA mem...ration Sodexo will hold a rally Tuesday, Dec. 1, 2...headquarters, 3800 Desire Parkway, New Orleans, to...y disciplinary policies that target employees who ...er. Sodexo employees who clean schools in the Reco...
Breaking Medicine News(10 mins):Health News:NCOA, Bedlin Brief Leading Aging Organizations on Health Care Reform, Needed Long-Term Care Provisions 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 3Health News:CBO Confirms That Premiums Will Increase Under the Senate Healthcare Reform Bill 2Health News:CT Scan Patients May Get Unnecessary Imaging 2Health News:As H1NI Hits New Orleans in Force: School Custodians to Hold Rally to Call on Contractor to Stop Penalizing Workers Coping With Illness 2
(Date:11/30/2009)...ratures continue to rise scientists are presented ...ecies respond and adapt. In a paper published in ...odriguez-Trelles and Dr Miguel Rodriguez assess th... of approximately 0.6˚C has already affected ...ng ecologists and evolutionary biologists is to pr...
(Date:11/30/2009)...report published in the December 2009 print issue ...lar type of control over their fertility that wome...sts have found how and where androgenic hormones w...on and male fertility. This opens a promising aven...discovery also offers hope to those who cannot hav...
(Date:11/26/2009)...r impressive antlers, red deer have been caught in... antlers are much more than decorative. They are l...ing. John Currey, from The University of York, UK,...f bone for over half a century and has become fasc...ugh a long-standing collaboration with Tomas Lande...
Breaking Biology News(10 mins):How can scientists measure evolutionary responses to climate change? 2Tough yet stiff deer antler is materials scientist's dream 2Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 1Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 2Hologic to Present at the 29th Annual Canaccord Adams Global Growth Conference 51475 1Hush little baby Linking genes brain and behavior in children 9237 1Hush little baby Linking genes brain and behavior in children 9237 2
Other Contentsridgeridgemicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadaches