Navigation Links


Budgets at Biology News

Budgets at Biology Products
Budgets at Biology Technology

Sarbanes-Oxley Act: The Next Y2K For IT Budgets?

CHICAGO There are lots of concerns by companies today to start reviewing the Sarbanes-Oxley Act and its effects on the IT area. Is the act a healthy antidote for devastated market faith? Adjunct Northwestern professor James Carlini explores in this week's edition of Carlinis Comments. The Sarbanes-Oxley Act</...
Budgets at Medicine News

Vulnerable Suffer As NHS Budgets

Elderly and sick people needing home care are suffering due to cuts in NHS expenditure, as councils struggle to deal with the situation, a study says.// The study, which has been commissioned by the Local Government Association (LGA), discovered that almost seven out of 10 local authorities, in areas with a NHS deficit, have suffered. Cost-cutting measures of the NHS, suc...
Budgets at Medicine Products
Budgets at Medicine Technology
Other TagsRemedyBattleBattleBattleVeilsVeilsPartnersPartnersPartnersBhutan
(Date:9/5/2008)...ert Pathologists Discuss the Latest Developments i...RTHFIELD, Ill., Sept. 5 /PRNewswire-USNewswire/ --...point. Molecular testing and the promise,of person...reated. Digital,slides and other imaging technolog...lege of American Pathologists is taking a leadersh...
(Date:9/5/2008)...hers explain how theoretical ,anti-cloak, could br...pt. 5 (HealthDay News) -- Just in case someone dev...cientists say they know how to uncloak the objects... Optics Express , certain materials underneath an ...o be seen again. , Researchers at Shanghai Jiao...
(Date:9/5/2008)...HINGTON, Sept. 5 /PRNewswire-USNewswire/ -- Speake...y in support of the aims of the "Stand,Up to Cance... "There is not a person in our country who has no...r kills 565,000 Americans annually, and each,year ...ricans must work,together to make eradicating the ...
(Date:9/5/2008)...HINGTON, Sept. 5 /PRNewswire-USNewswire/ -- U.S. c...r relief to Cuban victims of Hurricane,Gustav, whi...s., (http://www.PanAmericanRelief.org ), "Donatio...perately need,after this natural disaster," says M... Initiative at the Pan American Development Founda...
Breaking Medicine News(10 mins):Health News:Leaders in Pathology Meet in San Diego: Sept. 25 - 28, 2008 2Health News:Cuban Disaster Relief Donations Sought in the Wake of Hurricane Gustav 2
(Date:9/5/2008)... available in French and Spanish . , Researc...ion and Bromatology and Department of Chemistry-...ed out a study in which they have revealed the nee...opulation who follows Ramadan. , According to th...ient consumption levels are not appropriate if com...
(Date:9/4/2008)...s at the M.D. Anderson Cancer Center have develope...cifically for African Americans that suggests a gr...ase (COPD), according to a report published in the...a journal of the American Association for Cancer R...rom 491 African Americans with lung cancer and 497...
(Date:9/4/2008)... numerous plant-parasitic nematodes in the world, ... part of an estimated $157 billion in agricultural...orms that burrow into plant roots and feed off liv...ers have contributed to the release of the annotat...: Meloidogyne incognita -- the southern root-kno...
(Date:9/4/2008)...Subtle genetic changes that confer an evolutionary...haracteristic of the human hand, while difficult t...ystem, have nevertheless generated keen interest a...hed online in the September 5 edition of the journ... of Energy,s Lawrence Berkeley National Laboratory...
Breaking Biology News(10 mins):Nutritionists of the UGR suggest diet improvements during Ramadan 2African-Americans have unique lung cancer risks from chronic obstructive pulmonary disease 2ISU researchers help map first plant-parasitic nematode genome sequence 2Thumbs up -- a tiny ancestral remnant lends developmental edge to humans 2Thumbs up -- a tiny ancestral remnant lends developmental edge to humans 3Official Ground Breaking Ceremony for Cleveland Clinic Abu Dhabi 10306 1Official Ground Breaking Ceremony for Cleveland Clinic Abu Dhabi 10306 2Official Ground Breaking Ceremony for Cleveland Clinic Abu Dhabi 10306 3Official Ground Breaking Ceremony for Cleveland Clinic Abu Dhabi 10306 4AAFP Statement Family Physicians to President Bush 3A Call for Improved Health Access is Only One Step to Comprehensive Reform 10304 1AAFP Statement Family Physicians to President Bush 3A Call for Improved Health Access is Only One Step to Comprehensive Reform 10304 2AAFP Statement Family Physicians to President Bush 3A Call for Improved Health Access is Only One Step to Comprehensive Reform 10304 3Severe asthma may be a different form of the disease 2037 1Severe asthma may be a different form of the disease 2037 2Severe asthma may be a different form of the disease 2037 3BIO key 28R 29 Receives 24344 000 Contract Award from Hawaii County 2036 1BIO key 28R 29 Receives 24344 000 Contract Award from Hawaii County 2036 2BIO key 28R 29 Receives 24344 000 Contract Award from Hawaii County 2036 3
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria