Navigation Links


Brits in Medical News

A Growing Number of Brits Cross the Atlantic for Donor Egg IVF Treatment at Shady Grove Fertility Center

Reverse medical tourism driven by donor egg availability and lower cost, innovative IVF financing options ROCKVILLE, Md., June 16 /PRNewswire-USNewswire/ -- More and more couples from the United Kingdom are crossing the ocean for donor egg treatment at Shady Grove Fertility Center ( www.shad...

Selfridges and Cupron Bring Actual Beauty Sleep to Brits

Cupron Cosmetic Pillow Case - The Must-Have Skin Appearance Beauty Product! Selfridges is the UK's exclusive retail provider of the Cupron Cosmetic Pillow Case, an incredible new product that reduces the appearance of wrinkles and fine lines, while nourishing and deodorizing your skin as you slee...

Burnt Brits Don't Feel Hot

Nearly forty per cent (37 per cent) of British women and a quarter of British men have confessed that they have felt unattractive on holiday as a result of excessive exposure to the sun, according to a survey by Cancer Research UK*. This research has been conducted to highlight Sun Awareness Week,...

Radical Change in the Lifestyle Might Bring a Greener Future for Brits

Residents in the United Kingdom would have to consider a radical change in their lifestyles, if they want to enjoy a pollution-free and greener future, a report prepared by the Centre for Alternative Technology (CAT), has said. According to the report, the lifestyle changes could include h...

Transform, the Largest Plastic Surgery Clinic, States That Men Are More Vain Than Women

... of today's fast-paced, stressful life, or possibly the sudden surge of hair extensions, which can often result in balding. The top 10 body parts brits would like to change are as follows: WOMEN Tummy (37%) Weight (36%) Nothing (27%) Thighs (16%) ...

Stressed and Sedentary Lifestyles Increase as Recession Appears to Take its Toll on Britain's Health

..., Overworked and Overweight - 1.9 Million More brits Leading Unhealthy Lives Than Six Months Ago ...oday. Worryingly, nearly one in five (18 per cent) brits now admit they live unhealthy lifestyles, an incre... 50 per cent to 47 per cent. Almost half of brits (47 per cent) say they struggle to eat the recomme...

Brits Kiss With Confidence - Some More Than Others

...for HIV/Aids awareness projects in the UK. The research shows that most brits (57%) think they're either tremendous or good at kissing. A fifth admit the...uot;tonsil tennis" is the least favoured bit of kissing for a fifth of brits Toby Morgan, Values Manager for The Body Shop UK & RoI said: "T...

Is a cup of tea really the answer to everything -- even anthrax?

...y of Maryland has revealed how the humble cup of tea could well be an antidote to Bacillus anthracis more commonly know as anthrax. As a nation, brits currently drink 165 million cups of tea, and the healing benefits of the nations favourite beverage have long been acknowledged. But now the team...

More Than Humour or Great Look It is the Kissing Skills That Work Wonders!

... Most brits dont believe that a good sense of humour or great ... dating agency Match.com reveals that one in three brits have dumped a lover because they were a miserable ...the best kissers, and six in 10 people agreed that brits are the best kissers in the worlds. They w...

Pete Doherty "not Ready" to Quit Drug Use

...other house with some of the celebrities. According to British tabloid the Sun, Doherty emerged as the least liked flatmate with six out of 10 brits claiming that they would not want to share the house with him. ...
Brits in Biological Technology

High tech in the U.K. Do the Brits forgo Web 2.0?

This week, I'm in the United Kingdom, getting a snapshot of the start-up scene here. I've come across some tremendously fascinating companies. One company is undercutting the likes of Tivoli and HP by offering easily integrated and deployed system management tools for the SME market. A...

World Sight Day - Britons at Risk of Losing Their Sight by Not Having Regular Eye Tests

...vey supported by Pfizer Ltd. reveals that UK adults are more likely to visit their GP and dentist than they are their optician, with less than half of brits having had their eyes tested during the last five to ten years, and 1 in 5 would only visit an optician when a problem is obvious(5). Further research...

U.S. health system could undermine EHR progress

...e "150 percent." The United Kingdom, he noted, has spent billions of dollars to develop its health information infrastructure, but the first thing the brits did was divide the project into five regions because "they know these statistics." Yasnoff said the eHealth Trust model could work on a regional ba...

We're "Jaman": Purpose-driven browsers drive next wave of Web applications

...and application. It's the way rich experiences get even richer. Recent articles by Chris Shipley Chris Shipley: High tech in the U.K. Do the brits forgo Web 2.0? Chris Shipley: Age of empowered individuals: People power behind robust computing More enterprise software predictions for ...

Coveted vacation "disconnect" was elusive

...pley Chris Shipley: We're "Jaman": Purpose-driven browsers drive next wave of Web applications Chris Shipley: High tech in the U.K. Do the brits forgo Web 2.0? Chris Shipley: Age of empowered individuals: People power behind robust computing More enterprise software predictions for ...

Tired of the spin? ExpertVoter website makes candidate selection easier

...sive Chris Shipley: We're "Jaman": Purpose-driven browsers drive next wave of Web applications Chris Shipley: High tech in the U.K. Do the brits forgo Web 2.0? Chris Shipley: Age of empowered individuals: People power behind robust computing More enterprise software predictions for ...

On the Web, attention spans shrink, the need for value rises

...sive Chris Shipley: We're "Jaman": Purpose-driven browsers drive next wave of Web applications Chris Shipley: High tech in the U.K. Do the brits forgo Web 2.0? Chris Shipley: Age of empowered individuals: People power behind robust computing Chris Shipley is the executive producer of...

Turbo Tax Online can teach new Web concepts a business lesson

...sive Chris Shipley: We're "Jaman": Purpose-driven browsers drive next wave of Web applications Chris Shipley: High tech in the U.K. Do the brits forgo Web 2.0? Chris Shipley is the executive producer of NetworkWorld's DEMO Conferences, Editor of DEMO Letter, and a technology industry analy...

Delivering value instead of advertising - what a concept!

...sive Chris Shipley: We're "Jaman": Purpose-driven browsers drive next wave of Web applications Chris Shipley: High tech in the U.K. Do the brits forgo Web 2.0? Chris Shipley is the executive producer of NetworkWorld's DEMO Conferences, Editor of DEMO Letter, and a technology industry analy...
Other TagsplayersSolomonfilmfilmfilmfilmhonorhonorassistsforecast
(Date:11/25/2009)....25/PRNewswire/-SentinelleMedicalInc.,aleadingmanu...ftwarelaunchesasuiteofnewleadingedgeclinicalapplic...atthisyear,sRadiologicalSocietyofNorthAmerica(RSNA...0,HallA).Theapplicationsleveragetheuniquehighquali...ngcoilsandsupportmultipleimagingmodalitiesformulti...
(Date:11/25/2009)...icalEndorsements,Business,andPressJoinEfforttoEduc...ire/--Onceagain,theNationalBipolarFoundationandthe...heir"Safe,tilStable"program,whichisnowbeingwidelya...order.Today,theNationalBipolarFoundationreceivedap...ailfromtheLt.GovernorofLouisianaMitchLandrieu.TheN...
(Date:11/25/2009)... period was too short to draw definite conclusions...HealthDay News) -- In diabetic patients with block...rence in outcomes at one year whether patients und...British researchers report. , Bypass surgery ha...s with coronary artery disease. However, less inva...
(Date:11/25/2009)...te, CDC sees few signs of trouble with the H1N1 va...y News) -- The ongoing H1N1 swine flu pandemic may... among younger patients, a U.S. health official sa...erious pneumococcal infections around the country,...er for Immunization and Respiratory Diseases at th...
(Date:11/25/2009)...eat colorectal cancer also can reverse a rare stom...herapy for the disease, researchers at Vanderbilt ...rier,s disease causes thickening of the stomach li...as well as anemia and swelling in the feet and ank... risk for gastric cancer. Previously, the only eff...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3Health News:Stenting May Equal Bypass for Diabetic Heart Patients 2Health News:Stenting May Equal Bypass for Diabetic Heart Patients 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2
(Date:11/24/2009)...el action of a remarkable class of ring-shaped pro... the Lawrence Berkeley National Laboratory (Berkel...graphy beamline at the Advanced Light Source (ALS)...expression and replication, and are vital to the s...ious agents, such as the human papillomavirus, whi...
(Date:11/24/2009)... (November 24, 2009) New research on bacterial co...tems reveals predictable temporal patterns, sugges...s markers for monitoring climate change in the pol... Proceedings of the National Academy of Sciences ... the six rivers shifted synchronously over time, c...
(Date:11/23/2009)...ember 23, 2009 - The time of day matters to forest...per produced by a research team led by Professor M...,s vice-principal for research and colleagues in t...t. George campus. , Capitalizing on their prev... the research team examined how poplar trees use t...
Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2Atomic-level snapshot catches protein motor in action 3Atomic-level snapshot catches protein motor in action 4Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Time of day matters to thirsty trees, U of T researcher discovers 2Combo Treatment May Ease Depression After Stroke 53891 1Combo Treatment May Ease Depression After Stroke 53891 2Stroke Doubles Risk of Hip Thigh Fractures 53889 1Stroke Doubles Risk of Hip Thigh Fractures 53889 2Stroke Doubles Risk of Hip Thigh Fractures 53889 3Carnegie donates landmark clones to biology 9509 1Carnegie donates landmark clones to biology 9509 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia