Navigation Links


Biologist at Biology News

Octopuses occasionally stroll around on two arms, UC Berkeley biologists report

In a stunning example of evolution at work, scientists have now found that changes in a single gene can produce major changes in the skeletal armor of fish living in the wild. "Our motivation is to try to understa...

GeneNotes - A novel information management software for biologists

Analyzing microarray data - or even a simple biological network - can get you lost - quick. Tons of genes, tons of synonyms for each, tons of known interactions, with even more being unknown, tons of database with tons of information... and your job is to make sense of this puzzle in a biologically meaningfull way. Applications are being developped to make it all easier, leaving the fun part...

Biologists discover why 10% of Europeans are safe from HIV

Biologists at the University of Liverpool have discovered how the plagues of the Middle Ages have made around 10% of Europeans resistant to HIV. Scientists have known for some time that these individuals carry a genetic mutation (known as CCR5-delta32) that prevents the virus from entering the cells of the immune system but have been unable to account for the high levels of the gene in Scandinavi...

Biologists determine genetic blueprint of social amoeba

An international team that includes biologists at the University of California, San Diego has determined the complete genetic blueprint of Dictyostelium discoideum, a simple social amoeba long used by researchers as a model genetic system, much like fruit flies and laboratory mice, to gain a better understanding of human diseases. The scientific details of this seven-year-long genetic seq...

FSU biologists describe key role of signal-transcribing gene during cell cycle

Study in Oct. 1 'Development' shows when, where Alzheimer's, some cancers and genetic ills beginT. Biologists at Florida State University have uncovered the pivotal role of a gene called "Cut" that acts as a sort of middleman in cell-to-cell communication. A DNA-binding protein, Cut interprets and transcribes the developmental signals sent through the "Notch" gene, which regulates a layer...

More>>

Biologist at Biology Products
Biologist at Biology Technology

Biologist who cloned Dolly the sheep believes therapeutic cloning will gain acceptance

Wilmut, a biologist with the <a href="http://www.re...

Use of X-rays to advance wood-decay knowledge leads to honor for Forest Products Lab biologist

A biologist at the USDA Forest Service's Forest Products Laboratory in Madison has been honored for her innovative use of physics technology that has led to advances in understanding the molecular and chemical processes involved in fungal wood decay, opening the way to the development of new, environmentally preferable methods for protecting wood, the <a href="http://www.fpl...
Biologist at Biology Definition

Biologist

.Typically biologists study organisms and their relationship to their environment. Biologists involved in basic research attempt to discover under...
Biologist at Biology Dictionary

Biologist

isms and their relationship to their <a href="/ ?q=/ Biology-Di...
Biologist at Medicine News

Prestigious Gairdner Awards for medical research in 2006 Goes To Two Yale biologists

Two Yale Biologists and three other scientists will receive The Gairdner International Awards, 2006, among the most coveted awards in science, for their exemplary// research on RNAs, cell motility and hormones. The awards will be presented on October 26, in Toronto. John Dirks, president of the Gairdner Foundation said 'The 2006 awards honor outstanding achievements in our understandi...

Prestigious Wilson Award Goes To Yale Cell Biologist Joel Rosenbaum

Joel Rosenbaum, professor in the Department of Molecular, Cellular and Developmental Biology (MCDB) and faculty member at Yale since 1967, will be awarded// the prestigious 2006 E. B. Wilson Medal, the American Society for Cell Biology’s highest honor for scientific research in cell biology. The medal is indeed a recognition of Rosenbaum’s contribution on the assembly, maintenance an...

Biologists Trace Cause Of Early Blindness To Tissue Defect

Researchers at Texas A&M University are shedding light on a rare form of early blindness, identifying the cells involved and paving the way for possible therapies// to treat or even prevent what is currently an incurable disease. The findings, funded by Fight for Sight and the National Institutes of Health, are published in the March 5-9 online Early Edition (EE) of the Proceedings of...

MIT Biologists Solve Vitamin Puzzle

Solving a mystery that has puzzled scientists for decades, Massachusetts Institute of Technology (MIT) and Harvard researchers have discovered// the final piece of the synthesis pathway of vitamin B12--the only vitamin synthesized exclusively by microorganisms. B12, the most chemically complex of all vitamins, is essential for human health. Four Nobel Prizes have been awarded for rese...
Biologist at Medicine Products
Biologist at Medicine Technology
Other TagsRemedyBattleBattleBattleVeilsVeilsPartnersPartnersPartnersBhutan
(Date:9/5/2008)...ert Pathologists Discuss the Latest Developments i...RTHFIELD, Ill., Sept. 5 /PRNewswire-USNewswire/ --...point. Molecular testing and the promise,of person...reated. Digital,slides and other imaging technolog...lege of American Pathologists is taking a leadersh...
(Date:9/5/2008)...hers explain how theoretical ,anti-cloak, could br...pt. 5 (HealthDay News) -- Just in case someone dev...cientists say they know how to uncloak the objects... Optics Express , certain materials underneath an ...o be seen again. , Researchers at Shanghai Jiao...
(Date:9/5/2008)...HINGTON, Sept. 5 /PRNewswire-USNewswire/ -- Speake...y in support of the aims of the "Stand,Up to Cance... "There is not a person in our country who has no...r kills 565,000 Americans annually, and each,year ...ricans must work,together to make eradicating the ...
(Date:9/5/2008)...HINGTON, Sept. 5 /PRNewswire-USNewswire/ -- U.S. c...r relief to Cuban victims of Hurricane,Gustav, whi...s., (http://www.PanAmericanRelief.org ), "Donatio...perately need,after this natural disaster," says M... Initiative at the Pan American Development Founda...
Breaking Medicine News(10 mins):Health News:Leaders in Pathology Meet in San Diego: Sept. 25 - 28, 2008 2Health News:Cuban Disaster Relief Donations Sought in the Wake of Hurricane Gustav 2
(Date:9/5/2008)... available in French and Spanish . , Researc...ion and Bromatology and Department of Chemistry-...ed out a study in which they have revealed the nee...opulation who follows Ramadan. , According to th...ient consumption levels are not appropriate if com...
(Date:9/4/2008)...s at the M.D. Anderson Cancer Center have develope...cifically for African Americans that suggests a gr...ase (COPD), according to a report published in the...a journal of the American Association for Cancer R...rom 491 African Americans with lung cancer and 497...
(Date:9/4/2008)... numerous plant-parasitic nematodes in the world, ... part of an estimated $157 billion in agricultural...orms that burrow into plant roots and feed off liv...ers have contributed to the release of the annotat...: Meloidogyne incognita -- the southern root-kno...
(Date:9/4/2008)...Subtle genetic changes that confer an evolutionary...haracteristic of the human hand, while difficult t...ystem, have nevertheless generated keen interest a...hed online in the September 5 edition of the journ... of Energy,s Lawrence Berkeley National Laboratory...
Breaking Biology News(10 mins):Nutritionists of the UGR suggest diet improvements during Ramadan 2African-Americans have unique lung cancer risks from chronic obstructive pulmonary disease 2ISU researchers help map first plant-parasitic nematode genome sequence 2Thumbs up -- a tiny ancestral remnant lends developmental edge to humans 2Thumbs up -- a tiny ancestral remnant lends developmental edge to humans 3Official Ground Breaking Ceremony for Cleveland Clinic Abu Dhabi 10306 1Official Ground Breaking Ceremony for Cleveland Clinic Abu Dhabi 10306 2Official Ground Breaking Ceremony for Cleveland Clinic Abu Dhabi 10306 3Official Ground Breaking Ceremony for Cleveland Clinic Abu Dhabi 10306 4AAFP Statement Family Physicians to President Bush 3A Call for Improved Health Access is Only One Step to Comprehensive Reform 10304 1AAFP Statement Family Physicians to President Bush 3A Call for Improved Health Access is Only One Step to Comprehensive Reform 10304 2AAFP Statement Family Physicians to President Bush 3A Call for Improved Health Access is Only One Step to Comprehensive Reform 10304 3Severe asthma may be a different form of the disease 2037 1Severe asthma may be a different form of the disease 2037 2Severe asthma may be a different form of the disease 2037 3BIO key 28R 29 Receives 24344 000 Contract Award from Hawaii County 2036 1BIO key 28R 29 Receives 24344 000 Contract Award from Hawaii County 2036 2BIO key 28R 29 Receives 24344 000 Contract Award from Hawaii County 2036 3
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria