Navigation LinksBiology NewsHealth NewsBiology TechnologyMedicine Technology

We're sorry, that page ( was not found.

Search advocated at Google

Search advocated at Yahoo

Search advocated at Bing

(Date:5/6/2017)... , May 5, 2017 RAM ... announced a new breakthrough in biometric authentication based ... quantum mechanical properties to perform biometric authentication. These new ... semiconductor material created by Ram Group and its ... entertainment, transportation, supply chains and security. Ram Group ...
(Date:4/19/2017)... April 19, 2017 The global ... landscape is marked by the presence of several large ... held by five major players - 3M Cogent, NEC ... accounted for nearly 61% of the global military biometric ... in the global military biometrics market boast global presence, ...
(Date:4/17/2017)... Florida , April 17, 2017 NXT-ID, ... technology company, announces the filing of its 2016 Annual Report on ... and Exchange Commission. ... on Form 10-K is available in the Investor Relations section of ... as on the SEC,s website at . ...
Breaking Biology News(10 mins):
(Date:10/13/2017)... , ... October 13, 2017 , ... As health professionals ... known as “patient engagement.” The patient is doing more than filling out a survey; ... , “There is an increasing emphasis in health care and research on the importance ...
(Date:10/13/2017)... ... October 13, 2017 , ... Southern ... and Jennifer Huggins, PharmD ’17, along with clinical associate professor Janice Frueh, ... cardiovascular diseases during the 15th Annual Women’s Health Conference. The SIU School ...
(Date:10/13/2017)... ... October 13, 2017 , ... Ellevate Network, the leading network for professional ... action towards gender equality at their inaugural Summit in New York City in June. ... a social audience of over 3 million. To watch the Mobilize Women video, ...
(Date:10/13/2017)... ... October 13, 2017 , ... “The Journey: From the Mountains to the Mission ... lost souls in the Philippines. “The Journey: From the Mountains to the Mission Field” ... the Bible. She has taught all ages and currently teaches a class of ladies ...
(Date:10/12/2017)... ... October 12, 2017 , ... The ... demand of today’s consumer and regulatory authorities worldwide. From Children’s to Adults 50+, ... to meet the highest standard. , These products are also: Gluten Free, ...
Breaking Medicine News(10 mins):
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
Biology Products:
... Atrium introduces ProLite Ultra™, the next generation ... and traditional hernia surgery and general soft ... a thinner, better handling and more flexible ... further than ProLite Ultra. Its unique Litemesh™ ...
... Mesh plugs perform best when the surrounding ... with a smooth wall of highly compliant ... less tissue remodeling to help stabilize the ... more of the defect with gentle lateral ...
... pre-cut and pre-shaped to facilitate implantation for ... done. These pre-shaped onlays are available in ... are designed for use in both open ... and large sizes, they provide a tension-free ...
... As Bard, The Hernia Repair Company, we ... may desire limited fibrous tissue in-growth between ... compared to polypropylene mesh. Like all the ... Reconix Patch produces a clinically proven, versatile ...
Medicine Products:
(Date:10/10/2017)... CA (PRWEB) , ... October ... ... a development-stage cancer-focused pharmaceutical company advancing targeted antibody-drug conjugate (ADC) therapeutics, today ... of targeted HPLN (Hybrid Polymerized Liposomal Nanoparticle), a technology developed in collaboration ...
(Date:10/10/2017)... ... , ... Dr. Bob Harman, founder and CEO of VetStem Biopharma, Inc. ... The event entitled “Stem Cells and Their Regenerative Powers,” was held on August ... MPVM was joined by two human doctors: Peter B. Hanson, M.D., Chief of Orthopedic ...
(Date:10/10/2017)... SANTA CRUZ, Calif. , Oct. 10, 2017 /PRNewswire/ ... SBIR grant from the NIH to develop RealSeq®-SC (Single ... preparation kit for profiling small RNAs (including microRNAs) from ... Cell Analysis Program highlights the need to accelerate development ... "New techniques for ...
(Date:10/10/2017)... ... October 10, 2017 , ... The Pittcon Program Committee is ... honoring scientists who have made outstanding contributions to analytical chemistry and applied spectroscopy. ... world’s leading conference and exposition for laboratory science, which will be held February ...
Breaking Biology Technology:
(Date:9/19/2017)... ANN ARBOR, Mich. , Sept. 19, 2017 HistoSonics, Inc., a venture-backed medical ... the precise destruction of targeted tissues, announced three leadership team developments today:   ... Josh Stopek, PhD ... ... Veteran medical device executive ...
(Date:9/18/2017)... KALAMAZOO, Mich. , Sept. 18, 2017  PMD ... OptiMed Specialty Pharmacy of Kalamazoo, Mich. ... strategic hub service that expedites and streamlines patient and ... Spiro PD 2.0, and wellness management services.  ... medical device used to measure lung function for a ...
(Date:9/13/2017)... , Sept. 13, 2017   OrthoAtlanta has ... the Atlanta Football Host Committee (AFHC) for the 2018 College ... Jan. 8, 2018, at Mercedes-Benz Stadium in Atlanta, ... of the AFHC "I,m In" campaign, participating in many activities ... ...
Breaking Medicine Technology: