Navigation Links
Abnova in Medical News

BioInformatics, LLC New Report - Exploring the Epigenetics Market: Opportunities for Product Placement and Innovations

...faction with suppliers and desired improvements with each. The following suppliers were provided as choices in the survey: Abcam (LSE: ABC.L) abnova Active Motif Affinity Bioreagents (Thermo Fisher Scientific (NYSE: TMO )) Alexis Biochemicals (Enzo Life Sciences) (NYSE: ENZ ) Aviva Syst...
Abnova in Biological Technology

Assay Designs(TM), Inc. Announces Agreement with Abnova Corp. of Taiwan

ANN ARBOR, Mich., Nov. 5 /PRNewswire/ -- Assay Designs, Inc., a leading provider of immunoassay kits, antibodies, and reagents to the life science and translational research markets, has announced a strategic agreement with Abnova Corporation of Taiwan. The agreement enables Assay Designs to d...
Abnova in Biological Products

Mouse Anti-Human ATF3 Monoclonal Antibody, Unconjugated, Clone 7G10 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a full length recombinant ATF3. NCBI Entrez Gene ID = ATF3...
Company:Abnova Corporation

dsRNA Marker from Abnova Corporation

Description: The dsRNA Marker consists of ten double-stranded RNAs, 10, 20, 30, 50, 100, 200, 300, 400, 500 and 1,000 base pairs. The dsRNA Marker is an ideal size marker for determinating sizes of double-stranded RNAs. A twenty bp RNA band including in the dsRNA Marker is adjusted to approximately 25 ng/µ...
Company:Abnova Corporation

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPR...
Company:Abnova Corporation

Mouse Anti-Human FBXO24 Monoclonal Antibody, Unconjugated, Clone 7F12 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FBXO24. NCBI Entrez Gene ID = FBXO24...
Company:Abnova Corporation

Mouse Anti-Human WRB Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant WRB. NCBI Entrez Gene ID = 7485...
Company:Abnova Corporation

Mouse Anti-Human CALCOCO2 Monoclonal Antibody, Unconjugated, Clone 2H5 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant CALCOCO2. NCBI Entrez Gene ID = CALCOCO2...
Company:Abnova Corporation

Mouse Anti-Human PRG4 Monoclonal Antibody, Unconjugated, Clone 2A6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant PRG4. NCBI Entrez Gene ID = PRG4...
Company:Abnova Corporation

Mouse Anti-Human KCTD13 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant KCTD13. NCBI Entrez Gene ID = 253980...
Company:Abnova Corporation

Mouse Anti-Human SCARB2 Monoclonal Antibody, Unconjugated, Clone 1C8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant SCARB2. NCBI Entrez Gene ID = SCARB2...
Company:Abnova Corporation

Mouse Anti-Human FAAH Monoclonal Antibody, Unconjugated, Clone 4H8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FAAH. NCBI Entrez Gene ID = FAAH...
Company:Abnova Corporation

More>>

Other Tags
(Date:6/30/2015)... ... , ... AvePoint, the established leader in enabling enterprise collaboration across ... AvePoint Watermark, AvePoint MyWorld, and AvePoint PDF Aggregator – for ... streamline everyday business operations and take advantage of the latest Microsoft technologies to enhance ...
(Date:6/30/2015)... ... June 30, 2015 , ... The ... 28-31, 2015 at Disney’s Coronado Springs Resort in Lake Buena Vista, Florida, and ... year, this premiere event for psychiatric-mental health nursing draws more than 1,500 health ...
(Date:6/30/2015)... ... ... This Fourth of July, Peacock Alley celebrates the American ideals that ... commitment to quality, honesty and love of friends and family. These are the values ... of quilts, Peacock Alley was fully realized and grown while raising her family. Today, ...
(Date:6/29/2015)... St. Petersburg, FL (PRWEB) , ... June 30, 2015 , ... ... with a special 50% Off offer. The oil, ideal for natural skincare and ... a natural and easy way is something most people desire, and Oil Pulling can ...
(Date:6/29/2015)... ... 30, 2015 , ... With thousands of children in Utah Valley diagnosed on ... support center, planned at Utah Valley University, in Orem, Utah. The University has ... the building in which it will be housed. , Utah Valley has the highest ...
Breaking Medicine News(10 mins):Health News:AvePoint Enhances Workforce Productivity and Document Protection on Microsoft Office 365 with the Release of Three New Apps 2Health News:AvePoint Enhances Workforce Productivity and Document Protection on Microsoft Office 365 with the Release of Three New Apps 3Health News:AvePoint Enhances Workforce Productivity and Document Protection on Microsoft Office 365 with the Release of Three New Apps 4Health News:American Psychiatric Nurses Association 29th Annual Conference: Continuing Education and Collaboration in Psychiatric-Mental Health and Nursing 2Health News:American Psychiatric Nurses Association 29th Annual Conference: Continuing Education and Collaboration in Psychiatric-Mental Health and Nursing 3Health News:Luxury Linen Purveyor Peacock Alley Celebrates the Fourth of July 2Health News:New Product: Transform Wellness and Oral Health With This Ancient Ayurvedic Secret and Organic Product from Sublime Beauty NATURALS® 2Health News:doTERRA Partners With Utah Valley University on Autism Support Center 2Health News:doTERRA Partners With Utah Valley University on Autism Support Center 3
(Date:6/18/2015)... June 18, 2015 NXT-ID, Inc. (NASDAQ: NXTD ... on the growing mobile commerce market announces that its Wocket® ... on "Money on the Mark", scheduled to air on WABC ... June 20 th . The broadcast air- ... 7:00 to 8:00pm EST. NXT-ID, Inc.,s CEO Gino Pereira ...
(Date:6/17/2015)... JOSE, Calif. , June 17, 2015 /PRNewswire/ ... in human interface solutions, today announced that Xiaomi, ... adopted the Synaptics ® ClearPad ® ... of display driver integrated circuits (DDICs) for its ... Pro. By leveraging ClearPad for full in-cell display ...
(Date:6/16/2015)... NEW YORK , June 16, 2015  With ... the world, security remains a top concern. The recent ... confirms the need for strong authentication within government ... HYPR Token, a biometric one-time password (OTP) authenticator, has ... Processing Standards (FIPS) 140-2 Level 3 validation for tamper ...
Breaking Biology News(10 mins):NXT-ID, Inc.'s CEO Gino Pereira Talks About the Wocket Smart Wallet on WABC Radio, New York City, June 20th 2NXT-ID, Inc.'s CEO Gino Pereira Talks About the Wocket Smart Wallet on WABC Radio, New York City, June 20th 3Synaptics Touchscreen and Display Driver IC Solutions Power Xiaomi's Latest Flagship Smartphones 2Synaptics Touchscreen and Display Driver IC Solutions Power Xiaomi's Latest Flagship Smartphones 3Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 2Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 3
Other Contents