Abnova

Navigation Links

Biology News Medicine News Biology Products Medicine Products Biology Definition Medicine Definition Biology Technology Medicine Technology Biology Dictionary Medicine Dictionary

Abnova in Medical News

BioInformatics, LLC New Report - Exploring the Epigenetics Market: Opportunities for Product Placement and Innovations

...faction with suppliers and desired improvements with each. The following suppliers were provided as choices in the survey: Abcam (LSE: ABC.L) abnova Active Motif Affinity Bioreagents (Thermo Fisher Scientific (NYSE: TMO )) Alexis Biochemicals (Enzo Life Sciences) (NYSE: ENZ ) Aviva Syst...

Abnova in Biological Technology

Assay Designs(TM), Inc. Announces Agreement with Abnova Corp. of Taiwan

ANN ARBOR, Mich., Nov. 5 /PRNewswire/ -- Assay Designs, Inc., a leading provider of immunoassay kits, antibodies, and reagents to the life science and translational research markets, has announced a strategic agreement with Abnova Corporation of Taiwan. The agreement enables Assay Designs to d...

Abnova in Biological Products

Mouse Anti-Human ATF3 Monoclonal Antibody, Unconjugated, Clone 7G10 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a full length recombinant ATF3. NCBI Entrez Gene ID = ATF3...
Company:Abnova Corporation

dsRNA Marker from Abnova Corporation

Description: The dsRNA Marker consists of ten double-stranded RNAs, 10, 20, 30, 50, 100, 200, 300, 400, 500 and 1,000 base pairs. The dsRNA Marker is an ideal size marker for determinating sizes of double-stranded RNAs. A twenty bp RNA band including in the dsRNA Marker is adjusted to approximately 25 ng/µ...
Company:Abnova Corporation

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPR...
Company:Abnova Corporation

Mouse Anti-Human FBXO24 Monoclonal Antibody, Unconjugated, Clone 7F12 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FBXO24. NCBI Entrez Gene ID = FBXO24...
Company:Abnova Corporation

Mouse Anti-Human WRB Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant WRB. NCBI Entrez Gene ID = 7485...
Company:Abnova Corporation

Mouse Anti-Human CALCOCO2 Monoclonal Antibody, Unconjugated, Clone 2H5 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant CALCOCO2. NCBI Entrez Gene ID = CALCOCO2...
Company:Abnova Corporation

Mouse Anti-Human PRG4 Monoclonal Antibody, Unconjugated, Clone 2A6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant PRG4. NCBI Entrez Gene ID = PRG4...
Company:Abnova Corporation

Mouse Anti-Human KCTD13 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant KCTD13. NCBI Entrez Gene ID = 253980...
Company:Abnova Corporation

Mouse Anti-Human SCARB2 Monoclonal Antibody, Unconjugated, Clone 1C8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant SCARB2. NCBI Entrez Gene ID = SCARB2...
Company:Abnova Corporation

Mouse Anti-Human FAAH Monoclonal Antibody, Unconjugated, Clone 4H8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FAAH. NCBI Entrez Gene ID = FAAH...
Company:Abnova Corporation

More>>

Other TagsFacing Department Southwestern

Referendum Blooming Facing Logicalis Ashcroft Guild Meriter Watts Expetec Department Governing Hackers Southwestern Tennessee

(Date:11/26/2009)...heavy can lead to strains or worse , , T...nothing wrong with stuffing your turkey full to bu...g with your suitcase as you pack for holiday trips...8 in U.S. hospital emergency rooms, doctors, offic...ge-related injuries, such as muscle strains, pulls...

(Date:11/26/2009)...arch Triangle Dental (RTDental), a leading dental ...nounced the expansion of its services to include L... Macmillan. , Durham, ...to announce that Dr. Doug Macmillan, an experience...ional advanced training seminar. RTDental’s...

(Date:11/25/2009)...PRNewswire/--TheBartleHallConventionCenterwilltemp...9-10,whenKansasCityhoststhelatestinaseriesofmassiv...niceventhasthepotentialtobethebiggestoneyet,becaus...nweekdaysinsteadofoveraweekend,"SheriWood,executiv...ntoftheNationalAssociationofFreeClinics(NAFC). ,...

(Date:11/25/2009)...5/PRNewswire/--Thanksgivingmealswillbedeliveredtoa...eachareathankstoFaithInAction/VolunteerActionforAg...isionofSCANHealthPlan.Formorethan17yearstheseorgan...armThanksgivingmealstoseniorsinneedinLongBeach,Lak...ndingcities. ,, "Ourwarmholidaymealsaredelivere...

(Date:11/25/2009)...ments,Business,andPressJoinEfforttoEducate ,, ...gain,theNationalBipolarFoundationandtheMedicAlertF...ilStable"program,whichisnowbeingwidelyacceptedasap...,theNationalBipolarFoundationreceivedaproclamation...t.GovernorofLouisianaMitchLandrieu.TheNationalBipo...

Breaking Medicine News(10 mins):Health News:Pack Right for the Holidays to Avoid the ER 2 Health News:Dr. Douglas Macmillan Now Providing LUMINEERS at Research Triangle Dental 2 Health News:Kansas City Prepares for Largest Free Health Clinic 2 Health News:SCAN Employees and Community Volunteers to Help Deliver One Thousand Thanksgiving Meals to Homebound Seniors 2 Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2 Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3

[1] Pack Right for the Holidays to Avoid the ER [0] Dr. Douglas Macmillan Now Providing LUMINEERS at Research Triangle Dental [1] Kansas City Prepares for Largest Free Health Clinic [0] SCAN Employees and Community Volunteers to Help Deliver One Thousand Thanksgiving Meals to Homebound Seniors [0] First Time-Door is Open for Family Discussion of Bipolar Disorder

(Date:11/25/2009)...essors recently received funding from the National...eficial to understanding the environment. The thre..., assistant professor in the Department of Biologi...parate research projects. , His first project, t...d Functions from the Leaf to the Landscape," will ...

(Date:11/24/2009)... named 12 new grant recipients for 2009. The award...k across a broad spectrum of lupus research. All w...tential to drive scientific discovery to ultimatel...systemic lupus. , The 2009 grants go to both new...on and include interdisciplinary and highly promis...

(Date:11/24/2009)...eries from collapsing have been true life-savers. ...eeded -- once the arteries are strengthened, they ...ice but to leave them in place. , Prof. Meital Z...omedical Engineering has developed a new patent-pe...,re needed, then dissolves. , "Our new composite...

[0] Kent State University professors focus research on the environment with grants totaling $890,000 [2] Lupus Research Institute announces 2009 novel research grants [0] A coating for life

Other Contentspersonal personal personal personal personal personal personal personal personal pesticides pesticides pesticides pesticides pernicious mal mal petit pharmacology pharmacology pharmacology pharmacology pharmacology pharmacology pharmacist pharmacist pharmacist pharyngitis

personal pesticides pernicious mal petit pharmacology pharmacist pharyngitis