Navigation Links


Abnova in Medical News

BioInformatics, LLC New Report - Exploring the Epigenetics Market: Opportunities for Product Placement and Innovations

...faction with suppliers and desired improvements with each. The following suppliers were provided as choices in the survey: Abcam (LSE: ABC.L) abnova Active Motif Affinity Bioreagents (Thermo Fisher Scientific (NYSE: TMO )) Alexis Biochemicals (Enzo Life Sciences) (NYSE: ENZ ) Aviva Syst...
Abnova in Biological Technology

Assay Designs(TM), Inc. Announces Agreement with Abnova Corp. of Taiwan

ANN ARBOR, Mich., Nov. 5 /PRNewswire/ -- Assay Designs, Inc., a leading provider of immunoassay kits, antibodies, and reagents to the life science and translational research markets, has announced a strategic agreement with Abnova Corporation of Taiwan. The agreement enables Assay Designs to d...
Abnova in Biological Products

Mouse Anti-Human ATF3 Monoclonal Antibody, Unconjugated, Clone 7G10 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a full length recombinant ATF3. NCBI Entrez Gene ID = ATF3...
Company:Abnova Corporation

dsRNA Marker from Abnova Corporation

Description: The dsRNA Marker consists of ten double-stranded RNAs, 10, 20, 30, 50, 100, 200, 300, 400, 500 and 1,000 base pairs. The dsRNA Marker is an ideal size marker for determinating sizes of double-stranded RNAs. A twenty bp RNA band including in the dsRNA Marker is adjusted to approximately 25 ng/µ...
Company:Abnova Corporation

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPR...
Company:Abnova Corporation

Mouse Anti-Human FBXO24 Monoclonal Antibody, Unconjugated, Clone 7F12 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FBXO24. NCBI Entrez Gene ID = FBXO24...
Company:Abnova Corporation

Mouse Anti-Human WRB Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant WRB. NCBI Entrez Gene ID = 7485...
Company:Abnova Corporation

Mouse Anti-Human CALCOCO2 Monoclonal Antibody, Unconjugated, Clone 2H5 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant CALCOCO2. NCBI Entrez Gene ID = CALCOCO2...
Company:Abnova Corporation

Mouse Anti-Human PRG4 Monoclonal Antibody, Unconjugated, Clone 2A6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant PRG4. NCBI Entrez Gene ID = PRG4...
Company:Abnova Corporation

Mouse Anti-Human KCTD13 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant KCTD13. NCBI Entrez Gene ID = 253980...
Company:Abnova Corporation

Mouse Anti-Human SCARB2 Monoclonal Antibody, Unconjugated, Clone 1C8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant SCARB2. NCBI Entrez Gene ID = SCARB2...
Company:Abnova Corporation

Mouse Anti-Human FAAH Monoclonal Antibody, Unconjugated, Clone 4H8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FAAH. NCBI Entrez Gene ID = FAAH...
Company:Abnova Corporation

More>>

Other TagsFacingDepartmentSouthwestern
(Date:11/26/2009)...heavy can lead to strains or worse , , T...nothing wrong with stuffing your turkey full to bu...g with your suitcase as you pack for holiday trips...8 in U.S. hospital emergency rooms, doctors, offic...ge-related injuries, such as muscle strains, pulls...
(Date:11/26/2009)...arch Triangle Dental (RTDental), a leading dental ...nounced the expansion of its services to include L... Macmillan. , Durham, ...to announce that Dr. Doug Macmillan, an experience...ional advanced training seminar. RTDental’s...
(Date:11/25/2009)...PRNewswire/--TheBartleHallConventionCenterwilltemp...9-10,whenKansasCityhoststhelatestinaseriesofmassiv...niceventhasthepotentialtobethebiggestoneyet,becaus...nweekdaysinsteadofoveraweekend,"SheriWood,executiv...ntoftheNationalAssociationofFreeClinics(NAFC). ,...
(Date:11/25/2009)...5/PRNewswire/--Thanksgivingmealswillbedeliveredtoa...eachareathankstoFaithInAction/VolunteerActionforAg...isionofSCANHealthPlan.Formorethan17yearstheseorgan...armThanksgivingmealstoseniorsinneedinLongBeach,Lak...ndingcities. ,, "Ourwarmholidaymealsaredelivere...
(Date:11/25/2009)...ments,Business,andPressJoinEfforttoEducate ,, ...gain,theNationalBipolarFoundationandtheMedicAlertF...ilStable"program,whichisnowbeingwidelyacceptedasap...,theNationalBipolarFoundationreceivedaproclamation...t.GovernorofLouisianaMitchLandrieu.TheNationalBipo...
Breaking Medicine News(10 mins):Health News:Pack Right for the Holidays to Avoid the ER 2Health News:Dr. Douglas Macmillan Now Providing LUMINEERS at Research Triangle Dental 2Health News:Kansas City Prepares for Largest Free Health Clinic 2Health News:SCAN Employees and Community Volunteers to Help Deliver One Thousand Thanksgiving Meals to Homebound Seniors 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3
(Date:11/25/2009)...essors recently received funding from the National...eficial to understanding the environment. The thre..., assistant professor in the Department of Biologi...parate research projects. , His first project, t...d Functions from the Leaf to the Landscape," will ...
(Date:11/24/2009)... named 12 new grant recipients for 2009. The award...k across a broad spectrum of lupus research. All w...tential to drive scientific discovery to ultimatel...systemic lupus. , The 2009 grants go to both new...on and include interdisciplinary and highly promis...
(Date:11/24/2009)...eries from collapsing have been true life-savers. ...eeded -- once the arteries are strengthened, they ...ice but to leave them in place. , Prof. Meital Z...omedical Engineering has developed a new patent-pe...,re needed, then dissolves. , "Our new composite...
Breaking Biology News(10 mins):Kent State University professors focus research on the environment with grants totaling $890,000 2Lupus Research Institute announces 2009 novel research grants 2Lupus Research Institute announces 2009 novel research grants 3A coating for life 2BioCryst to Present at Oppenheimer Healthcare Conference 5852 1BioCryst to Present at Oppenheimer Healthcare Conference 5852 2Helix BioPharma Corp Announces Fiscal 2009 Results 5849 1Helix BioPharma Corp Announces Fiscal 2009 Results 5849 2Helix BioPharma Corp Announces Fiscal 2009 Results 5849 3Helix BioPharma Corp Announces Fiscal 2009 Results 5849 4Helix BioPharma Corp Announces Fiscal 2009 Results 5849 5Helix BioPharma Corp Announces Fiscal 2009 Results 5849 6Helix BioPharma Corp Announces Fiscal 2009 Results 5849 7Helix BioPharma Corp Announces Fiscal 2009 Results 5849 8Helix BioPharma Corp Announces Fiscal 2009 Results 5849 9Helix BioPharma Corp Announces Fiscal 2009 Results 5849 10Helix BioPharma Corp Announces Fiscal 2009 Results 5849 11Helix BioPharma Corp Announces Fiscal 2009 Results 5849 12Helix BioPharma Corp Announces Fiscal 2009 Results 5849 13Minnesota Charity Launches Global Initiative to Help Children and Families Fighting Chronic Illnesses 60354 1Minnesota Charity Launches Global Initiative to Help Children and Families Fighting Chronic Illnesses 60354 2
Other Contentspersonalpersonalpersonalpersonalpersonalpersonalpersonalpersonalpersonalpesticidespesticidespesticidespesticidesperniciousmalmalpetitpharmacologypharmacologypharmacologypharmacologypharmacologypharmacologypharmacistpharmacistpharmacistpharyngitis