Navigation Links
Abnova in Medical News

BioInformatics, LLC New Report - Exploring the Epigenetics Market: Opportunities for Product Placement and Innovations

...faction with suppliers and desired improvements with each. The following suppliers were provided as choices in the survey: Abcam (LSE: ABC.L) abnova Active Motif Affinity Bioreagents (Thermo Fisher Scientific (NYSE: TMO )) Alexis Biochemicals (Enzo Life Sciences) (NYSE: ENZ ) Aviva Syst...
Abnova in Biological Technology

Assay Designs(TM), Inc. Announces Agreement with Abnova Corp. of Taiwan

ANN ARBOR, Mich., Nov. 5 /PRNewswire/ -- Assay Designs, Inc., a leading provider of immunoassay kits, antibodies, and reagents to the life science and translational research markets, has announced a strategic agreement with Abnova Corporation of Taiwan. The agreement enables Assay Designs to d...
Abnova in Biological Products

Mouse Anti-Human ATF3 Monoclonal Antibody, Unconjugated, Clone 7G10 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a full length recombinant ATF3. NCBI Entrez Gene ID = ATF3...
Company:Abnova Corporation

dsRNA Marker from Abnova Corporation

Description: The dsRNA Marker consists of ten double-stranded RNAs, 10, 20, 30, 50, 100, 200, 300, 400, 500 and 1,000 base pairs. The dsRNA Marker is an ideal size marker for determinating sizes of double-stranded RNAs. A twenty bp RNA band including in the dsRNA Marker is adjusted to approximately 25 ng/µ...
Company:Abnova Corporation

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPR...
Company:Abnova Corporation

Mouse Anti-Human FBXO24 Monoclonal Antibody, Unconjugated, Clone 7F12 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FBXO24. NCBI Entrez Gene ID = FBXO24...
Company:Abnova Corporation

Mouse Anti-Human WRB Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant WRB. NCBI Entrez Gene ID = 7485...
Company:Abnova Corporation

Mouse Anti-Human CALCOCO2 Monoclonal Antibody, Unconjugated, Clone 2H5 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant CALCOCO2. NCBI Entrez Gene ID = CALCOCO2...
Company:Abnova Corporation

Mouse Anti-Human PRG4 Monoclonal Antibody, Unconjugated, Clone 2A6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant PRG4. NCBI Entrez Gene ID = PRG4...
Company:Abnova Corporation

Mouse Anti-Human KCTD13 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant KCTD13. NCBI Entrez Gene ID = 253980...
Company:Abnova Corporation

Mouse Anti-Human SCARB2 Monoclonal Antibody, Unconjugated, Clone 1C8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant SCARB2. NCBI Entrez Gene ID = SCARB2...
Company:Abnova Corporation

Mouse Anti-Human FAAH Monoclonal Antibody, Unconjugated, Clone 4H8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FAAH. NCBI Entrez Gene ID = FAAH...
Company:Abnova Corporation

More>>

Other Tags
(Date:9/23/2014)... New York, N.Y. (PRWEB) September 23, 2014 ... supplement to join the Royal Sport LTD family of ... 100 calories and 20g of pure Whey protein without ... , This ‘Ultra Clean’ protein is available on shelves ... Royal Sport LTD website—where the brand is offering a ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 ... is the process of translating the entire verbal ... therapeutic procedures, and prognosis, into a readable textual ... patients, and healthcare providers. With attending physicians unable ... patient’s condition, outsourcing of such documentation to medical ...
(Date:9/23/2014)... ADOMANI, Inc. has announced that industry expert Jim ... a 13-year veteran in the school, commercial and transit bus ... Sales of Colton, California. While with A-Z Mr. Reynolds was ... revenues, profit and market penetration by double digits. , ADOMANI ... or plug-in hybrid vehicle conversions. They have converted a ...
(Date:9/23/2014)... September 23, 2014 If you or ... dressing for the treatment may be a challenge. Fortunately, ... of garment that is designed to improve the experience. ... receive dialysis without having to remove, tear or reposition ... privacy and preserving their dignity. At the same time, ...
(Date:9/23/2014)... Airbus Helicopters Inc. (AHI) is proud to ... 2014 Vision Zero Aviation Safety Award recipient ... free flight safety service the company provides the air ... Medical Specialist for Airbus Helicopters Inc., presented Protean CEO ... the Air Medical Transport Conference Annual Community Awards banquet ...
Breaking Medicine News(10 mins):Health News:Sports Nutrition Brand, Royal Sport LTD, Introduces 'Clean,' Gluten Free Protein Supplement, Royal Sport Ultra Clean 100™ 2Health News:Expanding Healthcare Sector Drives Demand for Medical Transcription Services, According to New Report by Global Industry Analysts, Inc. 2Health News:Expanding Healthcare Sector Drives Demand for Medical Transcription Services, According to New Report by Global Industry Analysts, Inc. 3Health News:ADOMANI Announces Jim Reynolds to Take Over as President and CEO 2Health News:Apparel for Dialysis Patients Invented by InventHelp Client (CBA-2492) 2Health News:Protean wins Airbus Helicopters Vision Zero Aviation Safety Award 2Health News:Protean wins Airbus Helicopters Vision Zero Aviation Safety Award 3Health News:Protean wins Airbus Helicopters Vision Zero Aviation Safety Award 4
(Date:9/23/2014)... whose turn it is to do the washing up, negotiating ... as many students returning to university for the new ... a house can be a tricky business. , And now ... that new technology to allow people to monitor their energy ... the tension. , The study by a team of technology ...
(Date:9/23/2014)... in the development of animals and plants. The central ... be translated in a reliable manner to give specific ... model of stripe formation is a classic paradigm in ... of the French flag, is caused by a gradient ... or low concentrations of the morphogen a "blue", "white" ...
(Date:9/23/2014)... majority of drugs used to treat asthma today are the ... are urgently needed to treat this chronic respiratory disease, which ... to wheeze, cough, and find it difficult at best to ... is tough: asthma is a patient-specific disease, so what works ... animal models traditionally used to test new drug candidates often ...
Breaking Biology News(10 mins):Smart meters could cause conflict for housemates, study shows 2Smart meters could cause conflict for housemates, study shows 3Recreating the stripe patterns found in animals by engineering synthetic gene networks 2Airway muscle-on-a-chip mimics asthma 2Airway muscle-on-a-chip mimics asthma 3
Other Contents