Navigation Links
Abnova in Medical News

BioInformatics, LLC New Report - Exploring the Epigenetics Market: Opportunities for Product Placement and Innovations

...faction with suppliers and desired improvements with each. The following suppliers were provided as choices in the survey: Abcam (LSE: ABC.L) abnova Active Motif Affinity Bioreagents (Thermo Fisher Scientific (NYSE: TMO )) Alexis Biochemicals (Enzo Life Sciences) (NYSE: ENZ ) Aviva Syst...
Abnova in Biological Technology

Assay Designs(TM), Inc. Announces Agreement with Abnova Corp. of Taiwan

ANN ARBOR, Mich., Nov. 5 /PRNewswire/ -- Assay Designs, Inc., a leading provider of immunoassay kits, antibodies, and reagents to the life science and translational research markets, has announced a strategic agreement with Abnova Corporation of Taiwan. The agreement enables Assay Designs to d...
Abnova in Biological Products

Mouse Anti-Human ATF3 Monoclonal Antibody, Unconjugated, Clone 7G10 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a full length recombinant ATF3. NCBI Entrez Gene ID = ATF3...
Company:Abnova Corporation

dsRNA Marker from Abnova Corporation

Description: The dsRNA Marker consists of ten double-stranded RNAs, 10, 20, 30, 50, 100, 200, 300, 400, 500 and 1,000 base pairs. The dsRNA Marker is an ideal size marker for determinating sizes of double-stranded RNAs. A twenty bp RNA band including in the dsRNA Marker is adjusted to approximately 25 ng/µ...
Company:Abnova Corporation

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPR...
Company:Abnova Corporation

Mouse Anti-Human FBXO24 Monoclonal Antibody, Unconjugated, Clone 7F12 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FBXO24. NCBI Entrez Gene ID = FBXO24...
Company:Abnova Corporation

Mouse Anti-Human WRB Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant WRB. NCBI Entrez Gene ID = 7485...
Company:Abnova Corporation

Mouse Anti-Human CALCOCO2 Monoclonal Antibody, Unconjugated, Clone 2H5 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant CALCOCO2. NCBI Entrez Gene ID = CALCOCO2...
Company:Abnova Corporation

Mouse Anti-Human PRG4 Monoclonal Antibody, Unconjugated, Clone 2A6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant PRG4. NCBI Entrez Gene ID = PRG4...
Company:Abnova Corporation

Mouse Anti-Human KCTD13 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant KCTD13. NCBI Entrez Gene ID = 253980...
Company:Abnova Corporation

Mouse Anti-Human SCARB2 Monoclonal Antibody, Unconjugated, Clone 1C8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant SCARB2. NCBI Entrez Gene ID = SCARB2...
Company:Abnova Corporation

Mouse Anti-Human FAAH Monoclonal Antibody, Unconjugated, Clone 4H8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FAAH. NCBI Entrez Gene ID = FAAH...
Company:Abnova Corporation

More>>

Other Tags
(Date:7/30/2015)... ... July 30, 2015 , ... OSF Healthcare System has been ... Most Wired Survey conducted by Hospitals & Health Networks. This marks the fourth consecutive ... by The Sisters of the Third Order of St. Francis . , Health ...
(Date:7/30/2015)... ... 2015 , ... Women's dating coach Simone Myers has just ... interested in improving their love lives using specific "lines" designed to trigger powerful ... public early this morning, has drawn praise from several dating and relationship advice ...
(Date:7/30/2015)... ... July 30, 2015 , ... Eyepartner is ... victims in San Diego, California’s Gaslamp Quarter Plaza for five years this September. ... actively monitor the area for any suspicious activity. These cameras are in place ...
(Date:7/30/2015)... ... , ... Google recently announced that it will be disclosing any incidents involving ... June 8, 2015 article published by Nasdaq , the powerful tech company maintains ... computer-driven cars, which such industry players as Tesla CEO Elon Musk believe may very ...
(Date:7/30/2015)... ... July 30, 2015 , ... 24/7 Care ... Angeles, and San Bernardino counties, today announced that Dr. Michael Demoratz, PhD, LCSW, ... Demoratz is a strong proponent of early access to palliative care services for ...
Breaking Medicine News(10 mins):Health News:OSF HealthCare Named One of the Most Wired Systems 2Health News:OSF HealthCare Named One of the Most Wired Systems 3Health News:Lovetraction Lines - Review Examining Simone Myers' New Online Course Released 2Health News:Eyepartner Software Helps Victims in Gaslamp Quarter Plaza 2Health News:Eyepartner Software Helps Victims in Gaslamp Quarter Plaza 3Health News:New Google Policy on Reporting Driverless Auto Accidents Points Out Growing Complexity of Personal Injury Law in the 21st Century, Says Law Offices of Burg and Brock 2Health News:New Google Policy on Reporting Driverless Auto Accidents Points Out Growing Complexity of Personal Injury Law in the 21st Century, Says Law Offices of Burg and Brock 3Health News:24/7 Care At Home Welcomes Michael Demoratz, PhD, LCSW, CCM as New Palliative Care Administrator 2Health News:24/7 Care At Home Welcomes Michael Demoratz, PhD, LCSW, CCM as New Palliative Care Administrator 3
(Date:7/21/2015)... , July 21, 2015  NXT-ID, Inc. ... a biometric authentication company focused on the growing ... smart wallet, announces that it has filed provisional ... and Method. This invention highlights ... only authorizes an account, but also the user ...
(Date:7/9/2015)... 9, 2015  Synaptics Inc. (NASDAQ: SYNA ), a ... it will report financial results for the fourth quarter ... after the close of market. The company will host ... 2:00 p.m. PT (5:00 p.m. ET), during which management ... on the live call, analysts and investors should dial ...
(Date:7/8/2015)... NEW YORK , July 8, 2015  BD ... announced BD & Guidepoint Mentor, a new ... to Guidepoint,s expert network services. BD ... technologies to improve healthcare delivery and outcomes and, with ... start-up entrepreneur will be able to directly engage with ...
Breaking Biology News(10 mins):NXT-ID Patents Personalized Tokenized Payments for Next Generation Secure Payment Technology 2NXT-ID Patents Personalized Tokenized Payments for Next Generation Secure Payment Technology 3NXT-ID Patents Personalized Tokenized Payments for Next Generation Secure Payment Technology 4Synaptics to Report Fourth Quarter, Fiscal Year 2015 Results on July 30 2BD and Guidepoint Team to Connect Healthcare Start-up Companies With Business and Scientific Experts 2BD and Guidepoint Team to Connect Healthcare Start-up Companies With Business and Scientific Experts 3
Other Contents