Navigation Links
Abnova in Medical News

BioInformatics, LLC New Report - Exploring the Epigenetics Market: Opportunities for Product Placement and Innovations

...faction with suppliers and desired improvements with each. The following suppliers were provided as choices in the survey: Abcam (LSE: ABC.L) abnova Active Motif Affinity Bioreagents (Thermo Fisher Scientific (NYSE: TMO )) Alexis Biochemicals (Enzo Life Sciences) (NYSE: ENZ ) Aviva Syst...
Abnova in Biological Technology

Assay Designs(TM), Inc. Announces Agreement with Abnova Corp. of Taiwan

ANN ARBOR, Mich., Nov. 5 /PRNewswire/ -- Assay Designs, Inc., a leading provider of immunoassay kits, antibodies, and reagents to the life science and translational research markets, has announced a strategic agreement with Abnova Corporation of Taiwan. The agreement enables Assay Designs to d...
Abnova in Biological Products

Mouse Anti-Human ATF3 Monoclonal Antibody, Unconjugated, Clone 7G10 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a full length recombinant ATF3. NCBI Entrez Gene ID = ATF3...
Company:Abnova Corporation

dsRNA Marker from Abnova Corporation

Description: The dsRNA Marker consists of ten double-stranded RNAs, 10, 20, 30, 50, 100, 200, 300, 400, 500 and 1,000 base pairs. The dsRNA Marker is an ideal size marker for determinating sizes of double-stranded RNAs. A twenty bp RNA band including in the dsRNA Marker is adjusted to approximately 25 ng/µ...
Company:Abnova Corporation

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with GST tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPR...
Company:Abnova Corporation

Mouse Anti-Human FBXO24 Monoclonal Antibody, Unconjugated, Clone 7F12 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FBXO24. NCBI Entrez Gene ID = FBXO24...
Company:Abnova Corporation

Mouse Anti-Human WRB Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant WRB. NCBI Entrez Gene ID = 7485...
Company:Abnova Corporation

Mouse Anti-Human CALCOCO2 Monoclonal Antibody, Unconjugated, Clone 2H5 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant CALCOCO2. NCBI Entrez Gene ID = CALCOCO2...
Company:Abnova Corporation

Mouse Anti-Human PRG4 Monoclonal Antibody, Unconjugated, Clone 2A6 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant PRG4. NCBI Entrez Gene ID = PRG4...
Company:Abnova Corporation

Mouse Anti-Human KCTD13 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description: Mouse polyclonal antibody raised against a partial recombinant KCTD13. NCBI Entrez Gene ID = 253980...
Company:Abnova Corporation

Mouse Anti-Human SCARB2 Monoclonal Antibody, Unconjugated, Clone 1C8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant SCARB2. NCBI Entrez Gene ID = SCARB2...
Company:Abnova Corporation

Mouse Anti-Human FAAH Monoclonal Antibody, Unconjugated, Clone 4H8 from Abnova Corporation

Description: Mouse monoclonal antibody raised against a partial recombinant FAAH. NCBI Entrez Gene ID = FAAH...
Company:Abnova Corporation

More>>

Other Tags
(Date:4/23/2014)... rats exposed to high-energy particles, simulating conditions astronauts would ... in attention and slower reaction times, even when the ... The cognitive impairments which affected a large subset, ... to be linked to protein changes in the brain, ... true in humans, suggest it may be possible to ...
(Date:4/23/2014)... the gastro-intestinal tract has long been considered to be ... Sahlgrenska Academy have used refined microscopic techniques that indicate ... of the gastro-intestinal tract is only as large as ... The digestive tract, which passes from the mouth through ... length of about 5 meters in a normal adult, ...
(Date:4/23/2014)... The American Gastroenterological Association (AGA) Research Foundation is ... The AGA Research Scholar Awards program, launched in ... productive research careers in digestive diseases. This year, ... year allowing for three consecutive years of funding. ... who are paving the way for promising research ...
(Date:4/23/2014)... SEATTLE, Washington, April 21, 2014 Five for-profit ... total of $1.25 million in Proof of Concept ... from ideas into commercial products, the Life Sciences ... a $300,000 Entrepreneur Mentoring Program grant to the ... a statewide advisory network to train the next ...
(Date:4/23/2014)... in the journal Oncotarget , explored tumour ... or their own DNA signatures within the same ... design effective, targeted treatment strategies. , Firstly they ... and either the KRAS or BRAF mutation. Secondly, ... EGFR gene mutation have that specific mutation present ...
Breaking Medicine News(10 mins):Health News:Some astronauts at risk for cognitive impairment, animal studies suggest 2Health News:Some astronauts at risk for cognitive impairment, animal studies suggest 3Health News:The surface area of the digestive tract 'only' as large as a studio apartment 2Health News:AGA announces 2014 Class of AGA Research Scholars 2Health News:LSDF announces commercialization grants and Entrepreneur Mentoring Program 2Health News:Non-uniform genetic mutations identified in lung cancers could lead to targeted treatment 2
(Date:4/23/2014)... found evidence of an interaction between prenatal smoking ... in children, especially in girls. , "The interesting ... prenatal smoking will have behavioral problems. Some ... Assistant Professor at Sam Houston State University, College ... study. "One possible explanation for this is ...
(Date:4/23/2014)... yesterday, Argentina joins the European Molecular Biology Laboratory ... strengthens the ties between the European and Latin ... access to EMBL,s world-class facilities and programs, and ... inception, fostering excellent life science research and promoting ... EMBL,s mission," says EMBL Director General Iain Mattaj ...
(Date:4/23/2014)... coined term for novels and films which focus on the ... shows how these fictions serve as a mental laboratory that ... and imagine other living conditions. , "Global warming is ... it is also a cultural phenomenon in which meaning is ... we see. And there are so many of them now ...
Breaking Biology News(10 mins):Genetics risk, prenatal smoking may predict behavioral problems 2Fiction prepares us for a world changed by global warming 2Fiction prepares us for a world changed by global warming 3
Other Contents