Navigation Links


API at Biology News

Mouse brain cells rapidly recover after Alzheimer's plaques are cleared

Brain cells in a mouse model of Alzheimer'sdisease have surprised scientists with their ability to recuperateafter the disorder's characteristic brain plaques are removed.Researchers at Washington University School of Medicine in St. Louisinjected mice with an antibody for a key component of brain plaques,the amyloid beta (Abeta) peptide. In areas of the brain whereantibodies cleared plaque...

NYC's First Rapid HIV Drug-resistant AIDS Case Prompts Call to Step Up HIV Prevention

New York City's Public Health Department today issued a public health advisory after reporting the first documented case of an alarming, new, rapidly-progressing and highly drug resistant strain of HIV in a New York man who progressed from his initial HIV infection, thought to have occurred in mid-October 2004, to a largely untreatable strain of AIDS in just three months. According to City...

Researchers develop rapid diagnostic tool for pathogen identification

Researchers at Columbia University's Mailman School of Public Health and the Columbia Genome Center have designed and developed a sensitive new diagnostic technology platform, called “Mass Tag PCR,?that can simultaneously screen for multiple infectious agents. The new technology is addressed in a paper published in the February issue of the Centers for Disease Control and Prevention's (CDC) Emerg...

AIDS Public Awareness Campaign Expands Following Report Of Rapidly Progressive HIV

State Health Commissioner Antonia C. Novello, M.D., M.P.H., Dr.P.H., today announced the expansion of New York State's HIV/AIDS Public Awareness and Education campaign to help combat the potential spread of HIV and further protect New Yorkers from the virus that causes AIDS. Dr. Novello said, "In light of recent reports of a drug-resistant, rapidly progressive strain of HIV in New York Ci...

Prescription Drug Patches Gaining Ground, Tackling New Therapies

Created as an alternate route of drug administration to improve patient compliance and reduce drug side effects, prescription skin patches are rapidly becoming an important healthcare product category. While quietly gaining market share for the treatment of chronic conditions such as angina, hypertension and HRT, the technology is set to make further inroads as transdermal patches for a host of n...

More>>

API at Biology Products

Rapid-Screen Arrayed cDNA Library Panels Master Plates -Human Placenta from OriGene Technologies

Description:The Rapid-Screen cDNA Library Panels were designed for full-length gene cloning and require just three sets of PCRs to identify the desired cDNA clone. The first PCR analysis is performed in a 96-well "Master Plate," where each well contains plasmid DNA from 5,000 clones. Having identified the positive well(s) by gel electrophoresis of the reaction products, the second PCR analysis is carried out...
Company:OriGene Technologies

Rapid-Screen Arrayed cDNA Library Panels Master Plates -Human Heart from OriGene Technologies

Description:The Rapid-Screen cDNA Library Panels were designed for full-length gene cloning and require just three sets of PCRs to identify the desired cDNA clone. The first PCR analysis is performed in a 96-well "Master Plate," where each well contains plasmid DNA from 5,000 clones. Having identified the positive well(s) by gel electrophoresis of the reaction products, the second PCR analysis is carried out...
Company:OriGene Technologies

Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Testis from OriGene Technologies

Description:The Rapid-Screen cDNA Library Panels were designed for full-length gene cloning and require just three sets of PCRs to identify the desired cDNA clone. The first PCR analysis is performed in a 96-well "Master Plate," where each well contains plasmid DNA from 5,000 clones. Having identified the positive well(s) by gel electrophoresis of the reaction products, the second PCR analysis is carried out...
Company:OriGene Technologies

Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Brain (adult) from OriGene Technologies

Description:The Rapid-Screen cDNA Library Panels were designed for full-length gene cloning and require just three sets of PCRs to identify the desired cDNA clone. The first PCR analysis is performed in a 96-well "Master Plate," where each well contains plasmid DNA from 5,000 clones. Having identified the positive well(s) by gel electrophoresis of the reaction products, the second PCR analysis is carried out...
Company:OriGene Technologies

Rapid-Screen Arrayed cDNA Library Panels Master Plates -Mouse Embryo (12.5 - day) from OriGene Technologies

Description:The Rapid-Screen cDNA Library Panels were designed for full-length gene cloning and require just three sets of PCRs to identify the desired cDNA clone. The first PCR analysis is performed in a 96-well "Master Plate," where each well contains plasmid DNA from 5,000 clones. Having identified the positive well(s) by gel electrophoresis of the reaction products, the second PCR analysis is carried out...
Company:OriGene Technologies

More>>

API at Biology Technology

Simple, Sensitive, and Rapid Detection of FLAG -Tagged Fusion Proteins

-TaggedFusion Proteins Qiyi Xie Quinn Lu Tanya Hosfield Peter Pingerelli Weiping Yang Stratagene...

A Simple and Rapid Technique to Purify High-Quality Midiprep DNA

Stratagene A new technique is now available to quickly, easily, and reliably isolatehigh-purity plasmid DNA. The convenient spin-format eliminates the need forresin suspensions, gravity flow columns, and alcohol precipit...

CastAway Precast Gels for Rapid Automated DNA Sequence Analysis

Stephen Roemer Mary Jensen Harry Osterman MarkVanek LI-COR Biotechnology Division LI-COR and Stratagene release the first commercially available precastgels for automated DNA sequencing and genetic analysis. Stratagenes CastAway gels* for...

Fluorescence-Based Single-Tube Assays to Rapidly Detect Human Gene Mutations

Xiuyuan Hu Beti Belachew Lingyu Chen HaoqiangHuang Jason Zhang Stratagene can distinguish human DNA specimens that differ by a few nucleotides or only asingle nucl...

HSVision Molecular Beacon Detection Module Rapidly Detects Herpes Simplex Virus DNA

Single-tube amplification method for high-throughput screening of HSV Cindy Walker-Peach Beti Belachew Peter Pingerelli Melanie Palmer Dwight DuBois Stratagene Stratagene introduces the HSVision molecular beacon detectionmodule,...

More>>

API at Biology Dictionary

Capitulum

...

Capillary

Source: Noland, George B. 1983. General <a href="/ ?q=/ Biolog...

Capillaries

are thin-walled blood <a href="/ ?q=/ Biology-Dictio...

Apicomplexa

, some of which cause dangerous <a href="/ ?q=/ Biology-Dict...

Apical meristem

Full ar...
API at Medicine News

New Way to "See" Genes, Evaluate Effectiveness of Gene Therapies Discovered

This technology essentially renders the body transparent and will allow physicians to determine whether gene therapies reach targeted cells and work as they should. "The technology is expected to help patients with cancer and other illnesses, such as cardiovascular disease. The discovery is outlined in the August 2000, issue of the journal Nature Medicine. UCLA researchers plan to tes...

Gay capital reeling with rising HIV infection

The gay capital? of the world, San Francisco is now reeling under the shock waves of a rebound epidemic of HIV infection. In the past one-year the rate of infection has actually doubled in most areas and in some select high-risk pockets of gay men, who are also intra venous drug users, the rates are even higher. And what is the cause for this sudden spurt? Hold your breath! The successfu...

Alternative therapies popular with Parkinson's patients

Nearly half of people with Parkinson's disease are using one or more type of complementary and alternative medicine (CAM), such as vitamins, message or acupuncture. Researchers at Johns Hopkins University in the US have carried out a survey of more than 200 people with Parkinson's disease. Forty per cent use one or more forms of CAM - and 12 per cent use five or more different ones. There...

Smallpox Would Spread Rapidly

Smallpox was eradicated by 1979 and vaccination against the disease gradually ended around the world. But stockpiles of the smallpox virus remain in laboratories in the US, Russia and possibly other nations.// Recent fears of bioterrorism have ignited concerns that these stockpiles could be used to introduce the potentially deadly disease into the population, which is at present ill-prepa...

Breastfed babies grow rapidly

Researchers feel that, healthy infants breast-fed uniquely for the first three months of life grow faster than their formula-fed peers, but there are no differences in weight,// length or head circumference between the two groups by the time they reach the age of one year. The findings contradict research that suggests infants who are fed only breast-milk for the first year of life gai...

More>>

API at Medicine Products

RapidLoc Meniscal Repair System

Description:The RapidLoc Meniscal Repair System is a second-generation "all-inside" system that offers several advantages over current systems including "inside-out" suture repair techniques and current "all-inside" rigid implants. This system is quick, simple, reproducible, reliable, and flexible in many ways, all while decreasing iatrogenic morbidity....
Company:DePuy Mitek

RapidLab 248 Blood Gas Analyzer

Description:248 is fully automated blood gas systems offering a cost-effective solution for critical care testing in settings with low to medium workloads....
Company:Siemens Medical Solutions Diagnostics

Rapidlab 800 System

Description:The Rapidlab 800 System is a fully automated, upgradable platform that covers the key critical care whole blood parameters in addition to comprehensive on-board information management. Its modular design allows the basic blood gas model to be quickly and easily upgraded to include electrolytes, metabolites and CO-oximetry in a single unit. This versatility addresses changing clinical demands by e...
Company:Siemens Medical Solutions Diagnostics

Rapidlab 348 Blood Gas Analyzer

Description:348 is fully automated blood gas systems offering a cost-effective solution for critical care testing in settings with low to medium workloads....
Company:Siemens Medical Solutions Diagnostics

Rapidpoint 400

Description:The Rapidpoint 400 is a sophisticated whole blood analysis system that is designed specifically for point-of-care testing while also satisfying the stringent requirements of the central laboratory. A single, multiple-use measurement cartridge contains all of the components of a traditional laboratory analyzer. This long-lasting cartridge includes the sampling unit, all of the sensors and all cali...
Company:Siemens Medical Solutions Diagnostics

More>>

API at Medicine Technology

Rapid Whole Blood Testing for Infectious Mononucleosis Antibodies

The Epstein Barr virus (EBV), which causes infectious mononucleosis (IM), is one of the most common human viruses. EBV occurs worldwide, and most people become infected with EBV sometime during their lives. In the United States, as many as 95 percent of adults between 35 and 40 years of age have been infected. In most developed countries, including the U.S., infection with EBV most often occu...

Rapid Flu Tests May Prove Especially Helpful This Season

On October 5, Chiron Corporation notified the CDC that none of its influenza vaccine (Fluvirin) would be available for distribution in the United States for the current influenza season. In the wake of this sudden removal of nearly half of the anticipated American vaccine supply, medical officials and the general public have grown increasingly alarmed about the scarcity of vaccine and the ris...

Point of Care Cardiac Analyzers Yield Rapid Cardiac Marker Results

Clinical guidelines from the disciplines of cardiology and laboratory and emergency medicine have all emphasized the importance of cardiac markers in diagnosing or ruling out acute myocardial infarction. The measurement of cardiac troponins is especially useful in the large fraction of patients presenting with acute coronary syndrome (ACS) who have...

Testing for Human Papillomavirus

Human papillomaviruses (HPVs) are small, closed circle, double-stranded DNA viruses, which are classified by nucleic acid sequence homology rather than serologic reactivity. Genital HPVs are the most prevalent sexually transmitted pathogens. Of the approximately 50 anogenital HPVs, there are a limited number of high and intermediate risk types dete...

Avian (Bird) Flu: Is There a Role for Rapid Tests?

With human infections of bird flu (avian influenza) reported in Asia and Eastern Europe, public health officials have moved swiftly to develop policies on surveillance, diagnosis, and treatment. The virus in question is the H5N1 subtype of influenza A, which has become epidemic...

More>>

API at Medicine Definition

Body shaping

<table id="toc" c...
API at Medicine Dictionary

Tinea capitis

: A superficial <a hr...

Scrapie

More on or transmissible spongiform encephalopathies. Well-known <a href="/ ?q=/ Medicine-Dictionary/ pr...

Rapid heartbeat

- room immediately. When en route...

Rapid breathing

, shortness of breath is due the backflow of <a href="/ ?q=/ Medicine-Dictionary/ bloo...

Rapidly progressive

that results in damage within the glomerulus of the <a href="/ ?q=...

More>>

Other TagsDECDECDECDECDECDECDECTWARTWARTWARTWARTWARpneumoniae
(Date:10/9/2008).../PRNewswire/ -- This may sound like,science fictio...onally,acclaimed anti-aging Doctor, Al Sears MD, h...e TA-65 to the public through his private practice...evolutionary technology that is based on telomere ...located at the ends of all the,chromosomes and in ...
(Date:10/9/2008)...ational Opportunities for Those on the ... 9 /PRNewswire/ -- In recognition of National,Cust...onors its more than,590 customer service represent... activities this week and celebrating those comple...than 4 million inquiries a year, IBC,s CSRs are mo...
(Date:10/9/2008)...wire/ -- Nature,s Way Holding Company, a,subsidiar...als, a leading,worldwide producer of clinically pr...ire all outstanding shares of Enzymatic Therapy wi...reholder of Enzymatic Therapy. The,agreement is su...tures and,provides for customary conditions to clo...
(Date:10/9/2008)...ire/ -- DogChannel.com, the premier,online destina...og Medical,Conditions section, where visitors can ...ugh a list of symptoms., The symptom list, locate...led by Dog Fancy,s "Ask the Vet" expert Karla Rugh...ontains the 40 most common signs of a,sick dog, fr...
Breaking Medicine News(10 mins):Health News:Science Fiction Has Become Reality with Remarkable Anti-Aging Treatment Breakthrough - Turning Back the Biological Clock in Aging 2Health News:Science Fiction Has Become Reality with Remarkable Anti-Aging Treatment Breakthrough - Turning Back the Biological Clock in Aging 3Health News:Independence Blue Cross Celebrates Customer Service Week 2Health News:Schwabe, World Leader in Herbal Manufacturing Will Acquire Enzymatic Therapy Through Nature's Way Holding, Inc. 2Health News:Schwabe, World Leader in Herbal Manufacturing Will Acquire Enzymatic Therapy Through Nature's Way Holding, Inc. 3Health News:DogChannel.com Launches Online Guide to Dog Medical Conditions 2
(Date:10/10/2008)...e Peninsula Medical School in Plymouth, UK, have c...moderate exercise a day recommended to children fr...rising problem of childhood obesity. , Their res...of the journal "Archives of Diseases in Childhood....hich has followed the development of over 200 chil...
(Date:10/10/2008)...ale scientists have created nanowire sensors coupl... both sensitive and specific enough to be used for...to a report in Nano Letters . , The sensors use...igens signatures of bacteria, viruses or cancer c... they produce acid, and generate a tiny current in...
(Date:10/10/2008)...rhood may make us all go a little gooey, but it,s ...ental health researchers at The Australian Nationa...re for Mental Health Research (CMHR) at ANU sugge...ancy affects their cognitive functions, there is n...ave been released as part of Mental Health Week, w...
(Date:10/9/2008)...ct. 9 /PRNewswire-FirstCall/ -- Aware, Inc. (Nasda...gy and biometrics software,has scheduled a confer...ts,for the third quarter of 2008 on Thursday, Octo...el Tzannes and CFO Rick Moberg will host the,earni...by Thomson and can be accessed on the,Investor Rel...
Breaking Biology News(10 mins):Recommendations for children's exercise lacking say experts 2Sensitive nanowire disease detectors made by Yale scientists 2Pregnancy not turning minds to mush: Study 2Aware Announces Q3 2008 Earnings Conference Call 2Drug Combo Halves Death Risk for Severe COPD Patients 8901 1Drug Combo Halves Death Risk for Severe COPD Patients 8901 2AlphaRx Officers and Directors To Exercise Options Warrants and Retain Shares 8896 1AlphaRx Officers and Directors To Exercise Options Warrants and Retain Shares 8896 2KV Pharmaceutical Company Announces NYSE Listing Extension 8891 1KV Pharmaceutical Company Announces NYSE Listing Extension 8891 2KV Pharmaceutical Company Announces NYSE Listing Extension 8891 3Maxygen to Present at the JPMorgan 26th Annual Healthcare Conference 2401 1
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria