Navigation Links


oral at medicine technology

Phase 3 Results for Dabigatran Etexilate, an Investigational Oral Anticoagulant, Presented Today at the XXIst Congress of the International Society on Thrombosis and Haemostasis

RIDGEFIELD, Conn., July 11, 2007 /PRNewswire/ -- Phase 3 resultsfrom the RE-NOVATE(TM) trial demonstrated that oral dabigatranetexilate once daily, administered for an average of 33 days, wasnon-inferior to enoxaparin, also administered for an average of 33days, in preventing venous thromboembolism (VTE) and all-causemortality after total hip replacement surgery. In this trial, therate o...

Manhattan Pharmaceuticals Announces Results of Phase 2a Studies for Oral Oleoyl-estrone

- Results Fail to Demonstrate Meaningful Placebo Adjusted WeightLoss; Obesity Program to be Discontinued NEW YORK, July 09, 2007 /PRNewswire-FirstCall/ -- ManhattanPharmaceuticals, Inc. today announced results of the company's twoPhase 2a clinical trials of oral Oleoyl-estrone (OE). The resultsof both randomized, double-blind, placebo-controlled studies, onein common obesity and the other...

DOR BioPharma Announces Issuance of European Patent for Its Oral Multivalent Botulinum Toxin Vaccine BT-VACC

MIAMI, FL -- (MARKET WIRE) -- July 06, 2007 -- DOR BioPharma,Inc. (OTCBB: <a target="_blank" href='http://studio.financialcontent.com/Engine?Account=iwire&PageName=QUOTE&Ticker=DORB"%3EDORB'>http://studio.financialcontent.com/Engine?Account=iwire&PageName=QUOTE&Ticker=DORB">DORB )("DOR" or the "Company") announced today that the European PatentOffice has granted a paten...

Portola Pharmaceuticals Announces Positive Phase II EXPERT Results and Additional Oral and Poster Presentations at the XXI Congress of the International Society on Thrombosis and Haemostasis (ISTH)

SOUTH SAN FRANCISCO, July 02, 2007 /PRNewswire/ -- PortolaPharmaceuticals, Inc. announced today that it will present clinicaland preclinical data on its oral Factor Xa inhibitor and on itsintravenous and oral ADP receptor antagonist at the XXI Congress ofthe International Society of Thrombosis and Haemostasis (ISTH) inGeneva, Switzerland on July 6 through July 12, 2007. The EXPERT...

Fact Sheet: Advancing Stem Cell Research While Respecting Moral Boundaries

WASHINGTON--(BUSINESS WIRE)--Jun 20, 2007 - Today, President BushSigned An Executive Order To Strengthen Our Nation's Commitment ToResearch On Pluripotent Stem Cells. Scientists have recently shownthey have the ingenuity and skill to pursue the potential benefitsof pluripotent stem cell research - research on cells that have thepotential to develop into nearly all the cell types and tissues...

Keryx Biopharmaceuticals, Inc. Announces Poster Presentations Highlighting Mechanism of Action and Clinical Activity of Sulonex(TM) (sulodexide oral gelcap) at the Upcoming American Diabetes Association 67th Scientific Sessions in Chicago, Illinois

NEW YORK, June 22, 2007 /PRNewswire-FirstCall/ -- KeryxBiopharmaceuticals, Inc. today announced that abstracts related toSulonex(TM) (sulodexide oral gelcap) have been selected forpublication or presentation during the poster sessions scheduled totake place at the upcoming American Diabetes Association (ADA) 67thAnnual Scientific Sessions and exposition at the McCormick PlaceLakeside Cen...

NovaDel Announces Positive Data from Two Studies Comparing Zolpidem Oral Spray to Ambien Tablets

FLEMINGTON, N.J.--(BUSINESS WIRE)--Jun 5, 2007 - NovaDel PharmaInc. (AMEX: NVD), a specialty pharmaceutical company developingoral spray formulations for a broad range of marketed treatments,today announced that its two clinical studies comparing zolpidemoral spray with zolpidem tablets have met their primarypharmacokinetic (PK), pharmacodynamic (PD) and safety objectives.Zolpidem tablets a...

Enzo Biochem Individualized Oral Immune Regulation Therapy May Be Effective Approach to Treating Crohn's Disease

WASHINGTON--(BUSINESS WIRE)--May 22, 2007 - Alequel(TM), anindividualized oral immune regulation preparation, may be aneffective treatment for moderate-to-severe Crohn's disease. Interimdata from two ongoing double-blind, placebo controlled Phase IIstudies suggest that this investigational approach induced goodclinical remissions and improved patients' quality of life comparedto placebo. Me...

Positive Clinical Data on CC-10004 Confirms Potential as Novel Oral Approach to Treating Inflammatory Diseases

Celgene to Advance Clinical and Regulatory Development of OralAnti-Inflammatory Franchise SUMMIT, N.J., May 22, 2007 /PRNewswire-FirstCall/ -- CelgeneCorporation announced its plans to advance the development ofleading oral anti-inflammatory candidates across a broad range ofinflammatory diseases. CC-10004 (apremilast), an oral TNFantagonist and anti-inflammatory agent has demonstrated si...

Laquinimod, a Novel Oral Compound, Showed Significant Reduction in Disease Activity in Patients with Relapsing-Remitting Multiple Sclerosis (RRMS)

JERUSALEM, & LUND, Sweden--(BUSINESS WIRE)--May 1, 2007 - TevaPharmaceutical Industries Ltd. and Active Biotech AB todayannounced that data from a 36-week, randomized, double-blind,placebo-controlled Phase IIb study demonstrated that an oral 0.6 mgdose of laquinimod given daily significantly reduced magneticresonance imaging (MRI) disease activity by 38 percent in RRMSpatients and was w...

ZIOPHARM Presents Data Highlighting Oral ZIO-101 at AACR

LOS ANGELES--(BUSINESS WIRE)--Apr 17, 2007 - ZIOPHARM Oncology,Inc. (NASDAQ: ZIOP) announced today the presentation of preclinicaldata strongly supportive of the development of an oral form ofZIO-101. Specifically, ZIO-101 demonstrates very highbioavailability when administered orally; in addition it evidencesanti-angiogenic activity that is particularly well suited to oraladministration. T...

AVEO Presents Preclinical Efficacy Data on AV-412, a Novel Oral Tyrosine Kinase Inhibitor of EGFR/HER2 for EGFR Mutant and Drug-Resistant Lung Cancer

LOS ANGELES & CAMBRIDGE, Mass.--(BUSINESS WIRE)--Apr 17, 2007 -AVEO Pharmaceuticals, Inc., a biopharmaceutical company focused onthe discovery and development of novel, targeted cancer medicines,today announced encouraging preclinical data of AV-412, a novel,next generation oral tyrosine kinase inhibitor of EGFR/HER2 usingAVEO's unique EGFR mutant and drug-resistant lung cancer tumormod...

ZIOPHARM Presents Data on Orally Active ZIO-201 at AACR

LOS ANGELES--(BUSINESS WIRE)--Apr 16, 2007 - ZIOPHARM Oncology,Inc. (NASDAQ: ZIOP) announced today the presentation of preclinicaldata for an orally active form of ZIO-201 (isophosphoramide mustard- IPM) at the American Association of Cancer Research meeting beingheld in Los Angeles. Data presented demonstrated oral availabilityof ZIO-201 and activity in a variety of cancer models, including...

Infinity and MedImmune to Present Preclinical Data From Study of Oral Formulation of IPI-504 At AACR

Infinity and MedImmune to Present Preclinical Data From Study ofOral Formulation of IPI-504 At AACR CAMBRIDGE, Mass. and GAITHERSBURG, Md., April 10, 2007 (PRIMENEWSWIRE) -- Infinity Pharmaceuticals, Inc. (Nasdaq:INFI) andMedImmune, Inc. (Nasdaq:MEDI) today announced that data from apreclinical study with an oral formulation of IPI-504 in non-smallcell lung cancer (NSCLC) will be presente...

Emisphere Technologies, Inc. Reports Clinical Data on Oral Delivery of GLP-1 and PYY

- Study shows orally-delivered GLP-1 is able to stimulate insulinrelease TARRYTOWN, N.Y., March 29, 2007 /PRNewswire-FirstCall/ --Emisphere Technologies, Inc. reported today results of two clinicalstudies conducted in collaboration with Professor ChristophBeglinger, M.D. Division of Gastroenterology and Hepatology,University Hospital Basel in Basel, Switzerland. The objective ofthe study...

ArQule Announces Acceptance of Clinical Data on ARQ 197, c-Met Inhibitor, for Oral Presentation at ASCO

WOBURN, Mass.--(BUSINESS WIRE)--Mar 14, 2007 - ArQule, Inc.(NASDAQ: ARQL) today announced that the American Society ofClinical Oncology (ASCO) has accepted for oral presentation theCompany's abstract for ARQ 197 (A Phase 1 Dose Escalation Study ofARQ 197, a Selective Inhibitor of the c-Met Receptor in Patientswith Metastatic Solid Tumors) at the 43rd ASCO Annual Meeting, June1-5, 2007, in C...

Schering-Plough Announces Presentation of Phase II Trial Results for Novel Oral Thrombin Receptor Antagonist at the 2007 Annual Meeting of The American College of Cardiology/i2 Summit

KENILWORTH, N.J., March 12, 2007 /PRNewswire-FirstCall/ --Schering-Plough Corporation announced today that results of thePhase II trial of its novel oral thrombin receptor antagonist (TRA)SCH 530348 will be presented at the 2007 annual Scientific Sessionsof the of Cardiology (ACC.07)/Innovation in Intervention (i2)Summit, March 24-27 in New Orleans. The Phase II trial, referred toas the...
Other TagsDECDECDECDECDECDECDECTWARTWARTWARTWARTWARpneumoniae
(Date:10/10/2008)...e Peninsula Medical School in Plymouth, UK, have c...moderate exercise a day recommended to children fr...rising problem of childhood obesity. , Their res...of the journal "Archives of Diseases in Childhood....hich has followed the development of over 200 chil...
(Date:10/10/2008)...ale scientists have created nanowire sensors coupl... both sensitive and specific enough to be used for...to a report in Nano Letters . , The sensors use...igens signatures of bacteria, viruses or cancer c... they produce acid, and generate a tiny current in...
(Date:10/10/2008)...rhood may make us all go a little gooey, but it,s ...ental health researchers at The Australian Nationa...re for Mental Health Research (CMHR) at ANU sugge...ancy affects their cognitive functions, there is n...ave been released as part of Mental Health Week, w...
(Date:10/9/2008)...ct. 9 /PRNewswire-FirstCall/ -- Aware, Inc. (Nasda...gy and biometrics software,has scheduled a confer...ts,for the third quarter of 2008 on Thursday, Octo...el Tzannes and CFO Rick Moberg will host the,earni...by Thomson and can be accessed on the,Investor Rel...
Breaking Biology News(10 mins):Recommendations for children's exercise lacking say experts 2Sensitive nanowire disease detectors made by Yale scientists 2Pregnancy not turning minds to mush: Study 2Aware Announces Q3 2008 Earnings Conference Call 2Drug Combo Halves Death Risk for Severe COPD Patients 8901 1Drug Combo Halves Death Risk for Severe COPD Patients 8901 2AlphaRx Officers and Directors To Exercise Options Warrants and Retain Shares 8896 1AlphaRx Officers and Directors To Exercise Options Warrants and Retain Shares 8896 2KV Pharmaceutical Company Announces NYSE Listing Extension 8891 1KV Pharmaceutical Company Announces NYSE Listing Extension 8891 2KV Pharmaceutical Company Announces NYSE Listing Extension 8891 3Maxygen to Present at the JPMorgan 26th Annual Healthcare Conference 2401 1
(Date:10/9/2008).../PRNewswire/ -- This may sound like,science fictio...onally,acclaimed anti-aging Doctor, Al Sears MD, h...e TA-65 to the public through his private practice...evolutionary technology that is based on telomere ...located at the ends of all the,chromosomes and in ...
(Date:10/9/2008)...ational Opportunities for Those on the ... 9 /PRNewswire/ -- In recognition of National,Cust...onors its more than,590 customer service represent... activities this week and celebrating those comple...than 4 million inquiries a year, IBC,s CSRs are mo...
(Date:10/9/2008)...wire/ -- Nature,s Way Holding Company, a,subsidiar...als, a leading,worldwide producer of clinically pr...ire all outstanding shares of Enzymatic Therapy wi...reholder of Enzymatic Therapy. The,agreement is su...tures and,provides for customary conditions to clo...
(Date:10/9/2008)...ire/ -- DogChannel.com, the premier,online destina...og Medical,Conditions section, where visitors can ...ugh a list of symptoms., The symptom list, locate...led by Dog Fancy,s "Ask the Vet" expert Karla Rugh...ontains the 40 most common signs of a,sick dog, fr...
Breaking Medicine News(10 mins):Health News:Science Fiction Has Become Reality with Remarkable Anti-Aging Treatment Breakthrough - Turning Back the Biological Clock in Aging 2Health News:Science Fiction Has Become Reality with Remarkable Anti-Aging Treatment Breakthrough - Turning Back the Biological Clock in Aging 3Health News:Independence Blue Cross Celebrates Customer Service Week 2Health News:Schwabe, World Leader in Herbal Manufacturing Will Acquire Enzymatic Therapy Through Nature's Way Holding, Inc. 2Health News:Schwabe, World Leader in Herbal Manufacturing Will Acquire Enzymatic Therapy Through Nature's Way Holding, Inc. 3Health News:DogChannel.com Launches Online Guide to Dog Medical Conditions 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria