Navigation Links


fin in Medical Technology

Novavax Reports Fourth Quarter and 2007 Year-End Financial Results

...ers in Rockville, Maryland, additional reserves for notes receivables from former board of directors, additional fees related to the implementation of fin 48 and additional personnel costs. As a result, total losses from continuing operations before interest was $6.7 million and $30.3 million for the f...

Tiny Cup Attached to Eye Improves Drug Delivery For Retinal Diseases

... services. It is the largest pediatric ophthalmology program in the nation with multiple subspecialty programs that are considered to be among today's finest resources for diagnosis, treatment and research. Founded in 1901, Children's Hospital Los Angeles has been treating the most seriously ill ...

Regular Yoga Practice Is Associated With Mindful Eating

...Hutchinson Cancer Research Center. The study was prompted by initial findings reported four years ago by Alan Kristal, Dr.P.H., and colleagues, who...al activity, such as walking or running, and mindful eating. "These findings fit with our hypothesis that yoga increases mindfulness in eating and...

Sanofi Pasteur Submits Supplemental Application for A(H1N1) Pandemic Vaccine to U.S. FDA

...ecurities Litigation Reform Act of 1995, as amended. Forward-looking statements are statements that are not historical facts. These statements include financial projections and estimates and their underlying assumptions, statements regarding plans, objectives, intentions and expectations with respect to...

Vectibix(R) in Combination With Chemotherapy Significantly Improved Progression-Free Survival in First-Line Metastatic Colorectal Cancer

...was significantly inferior in the Vectibix arm. These data confirm previous findings when oxaliplatin-based chemotherapy and an anti-EGFR antibody are com...estimates of revenues, operating margins, capital expenditures, cash, other financial metrics, expected legal, arbitration, political, regulatory or clini...

Isis Reports Strong Financial Results and Highlights for Second Quarter of 2009

...ticals, Inc. (Nasdaq: ISIS ) today announced its financial results for the quarter ended June 30, 2009...ash stock compensation expense. "Our strong financial performance is a direct result of the succe...es us with significant short and intermediate term financial benefits that enable us to continue to adva...

Juvenile Diabetes Research Foundation, The Genomics Institute of the Novartis Research Foundation Announce Innovative Diabetes Drug Discovery and Development Partnership

...in setting the agenda for diabetes research worldwide, and is the largest charitable funder and advocate of type 1 research. The mission of JDRF is to find a cure for diabetes and its complications through the support of research. Type 1 diabetes is a disease which strikes children and adults suddenly a...

Radius' Investigational Bone Anabolic Agent, BA058, Increased Bone Mineral Density (BMD) at Key Fracture Sites in Phase 2 Clinical Trial in Postmenopausal Osteoporosis

...osis and women's health. Radius has raised $106.5 million in private equity financing since its establishment in 2003 and is based in Cambridge, Massachusetts. Contact: Nick Harvey Chief financial Officer (617) 551-4704 ...

NOVAVAX Achieves Pandemic H1N1 Influenza Production Milestone

...atements Statements herein relating to future financial or business performance, conditions or strategies and other financial and business matters, including expectation...ces and visibility; our ability to obtain adequate financing in the future through product licensing, pu...

Nektar Therapeutics Reports Second Quarter 2009 Financial Results

... Therapeutics (Nasdaq: NKTR ) today reported its financial results for the second quarter ended June 3... Conference Call to Discuss Second Quarter 2009 financial Results A conference call to review...chief executive officer, and John Nicholson, chief financial officer, will host a conference call beginn...

CTMM Becomes One of the World's Largest Public-Private Partnerships in Translational Medical Research

... EINDHOVEN, The Netherlands, August 4 /PRNewswire/ -- With today's final approval of a research project into prostate cancer, the Dutch CTMM (Cen...f men," said Peter Luijten, CTMM Chief Scientific Officer. With this final project approval, CTMM has fulfilled the initial objectives of its busin...

Amgen Announces Positive Top-Line Results for Denosumab in Trial for Delay of Skeletal Related Events in Bone Metastases Patients Compared to Zometa(R)

... later this year. We are also looking forward to reviewing the results of a final SRE study, in patients with advanced prostate cancer, next year." ...estimates of revenues, operating margins, capital expenditures, cash, other financial metrics, expected legal, arbitration, political, regulatory or clini...

Telik Announces Publication of Positive Phase 1 Results of a Multicenter Study of Ezatiostat Hydrochloride (TELINTRA(R), TLK199) Tablets In Patients With Myelodysplastic Syndrome

... an intravenous formulation of TELINTRA were published earlier in the Journal of Hematology and Oncology, 13 May 2009; Vol. 2, No.20, pp. 20-32. The findings reported from these studies support the further development of TELINTRA. Phase 2 studies are ongoing in MDS (enrollment completion expected by ...

Project Zero Delay Accelerates Drug's Path to Clinical Trial

...onal research at M. D. Anderson and the paper's senior author. "We need to find out as promptly as possible whether new therapies will help. Zero Delay i...e Zero Delay paper indicates enrollment of the first patient after having a final protocol typically takes 3-6 months. Administrative tasks accompl...

TWO NEW KLRI PEER-REVIEWED PUBLICATIONS: Hormone Therapy May Reduce Atherosclerosis in Women Close to Menopause; Growth Hormone May Increase Risk of Diabetes, Improve Lipid Profile in Men

...ty for Reproductive Medicine's Menopausal Medicine , KLRI publications findings were twofold that there are certain benefits to menopausal hormone th...edical and lay communities understand important aging issues. KLRI research findings support a healthier quality of life and a robust lifestyle in our sen...

Access Pharmaceuticals Provides Update on ProLindac Clinical Development Program

...ASK) and several key oncology opinion leaders to finalize plans for ProLindac development in China. I... its Korean partner, JCOM of Seoul, South Korea to finalize development plans in that territory. Access...atory process with the SFDA. We are excited about finalizing protocols with ASK and the leading oncolog...

Shire Reports Positive Results From First of Three Phase III Trials of velaglucerase alfa for Type 1 Gaucher Disease and Provides Important Updates on Interactions With FDA

...ted adverse events were reported in association with velaglucerase alfa infusions, all of which were mild and resolved without sequelae. "These findings are very encouraging. They illustrate important potential benefits that velaglucerase alfa may provide to patients who are affected by Type 1 Ga...

John Legend and Gap Join (PRODUCT)RED(TM) to Help Eliminate AIDS in Africa with Exclusive (RED)ZONE Seating at Madison Square Garden

...the sales or portion of the profits from that product to the Global Fund to finance AIDS programs in Africa, with an emphasis on the health of women and c...aria Since its creation in 2002, the Global Fund has become the dominant financer of programs to fight AIDS, tuberculosis and malaria, with approved fu...

British Woman Celebrates a Year of Living Cancer-Free

...e next day, Ms. Scott was able to go home from the hospital. "I felt fine immediately. I was going out to dinner and things like that," Ms. Scott s...n't been. I've been working five days a week from 9 to 5. I've been feeling fine," Ms. Scott said. Her good health and good mood mark a sharp chang...

Study Results Show That Minimally Invasive Therapy is Successful for Over Two-Thirds of Stroke Patients Treated Outside the Standard Eight-Hour Window

... findings May Potentially Lead to New Approach to Stro...if the therapeutic window could be expanded, these findings could make a significant impact on the futur...atients. The possibilities are exciting, as these findings could very well mean that thousands of patie...

FDA Advisory Committee Votes in Favor of SAPHRIS(R) (asenapine) for Acute Bipolar I Disorder and Acute Schizophrenia

... from this new medication." While the FDA is not bound by the committee's recommendations, the agency carefully considers them before making a final decision on approval. After reviewing the SAPHRIS data, the committee voted in favor of SAPHRIS as effective (by counts of 12/0/0 and 10/2/0, yes/...

VisEn Molecular Imaging Technology Enables Key Insights Into Newly Discovered Biologic Pathway Published in SCIENCE

...rom the spleen to inflammatory sites, including myocardial infarction. The findings are expected to open up new areas of research and potentially advance...sue sites in the body to participate in wound healing. As presented in the findings, the reporting scientists discovered and detailed the biologic pathwa...

New Powder Speeds Healing of Difficult Foot Wounds

...rward to its future uses in treating notoriously difficult types of foot wounds we regularly encounter," added Vlahovic. To review the study's findings, visit www.apma.org/ASM09. Founded in 1912, the American Podiatric Medical Association (APMA) is the nation's leading and recognized prof...

Popular Breast Cancer Drug Used with Certain Antidepressants Puts New Jersey Women at Risk

... FRANKLIN LAKES, N.J., July 30 /PRNewswire-FirstCall/ -- A new analysis finds that women in New Jersey who take the breast cancer drug tamoxifen in conjunction with certain popular antidepressants may be at a higher risk for ...

Is Your Hair Taking a Break?

...ime due to a short growth phase, resulting in baby fine hairs that do not reach their full length or dia...et any known side effects -- such as irritation or fine facial hair that could develop along the cheeks ...sed off-label to treat female hair loss, including finasteride (which is FDA-approved for male-pattern h...

Diabetes Gene Raises Odds of Lower Birth Weight

...poses children to having a lower birth weight. The finding sheds light on a possible genetic influence o...journal Diabetes . "It's a bit unusual to find a gene linked to both prenatal events and to a d... a strong association with lower birth weight -- a finding that supports the so-called fetal insulin hyp...

Economy is Driving Many Osteoporotic Women to Retire Later - But Their Ability to Work May Be Undermined by Sub-Optimal Management of Their Disease

...ime off from work and lived the reality of the true physical, emotional and financial disruption of a broken bone in my life," said Pat Lindamood. "Women ... health, to help improve the lives of those affected by osteoporosis and to find a cure through programs of awareness, advocacy, public and health profess...

FDA Issues Complete Response Letter for INTUNIV(TM) (guanfacine) Extended Release for the Treatment of ADHD in Children and Adolescents

...s. "Shire is confident that we will quickly come to agreement on the final product label and anticipates a launch in the fourth quarter as planned,... Meeting; May 18, 2009; San Francisco, CA. 4. Arnsten AF, Scahill L, findling R. Alpha-2 adrenergic receptor agonists for the treatment of attentio...

Wyeth Reports Publication of Phase 3 Data for Bazedoxifene/Conjugated Estrogens, an Investigational Compound Being Studied for the Treatment of Menopausal Symptoms

...ts at http://www.fertstert.org/inpress . Titles and Summary of findings From Published Manuscripts 1. Endometrial Protection in Men...st and currency exchange rate fluctuations and volatility in the credit and financial markets; changes in generally accepted accounting principles; trade ...

Cryo-Cell Announces C'elle(SM) Research and Development Collaboration with Cryopraxis Cryobiology Ltd.

...her than C'elle can be commercialized, and the Company's development of its final business and economic model in offering any such service; any adverse ef... Kristin O'Neill 312-233-1295 Kristin.Oneill@edelman.com financial Media Inquiries: Cryo-Cell International, Inc. Investor Rela...

Cyberonics Provides Update on Depression Post-Approval Study

...les; the results of the previously disclosed governmental inquiries; the potential identification of material weaknesses in our internal controls over financial reporting; risks and costs associated with such governmental inquiries and any litigation relating thereto and other risks detailed from time t...

NeurogesX Announces Preliminary Results of FDA-Requested Qutenza(TM) Study

...ission. NeurogesX, Inc. The Ruth Group Stephen Ghiglieri Sara Pellegrino (investors) Chief financial Officer (646) 536-7002 (650) 358-3310 spellegrino@theruthgroup.com ...

Researchers Create First Targeted Knockout Rats Using Zinc Finger Nuclease Technology

... genetically modified mammals developed using zinc finger nuclease (ZFN) technology. (Photo: h...d "Knockout Rats via Embryo Microinjection of Zinc finger Nucleases," (Geurts, et al.) scientists used Z... Sigma-Aldrich, the sole source of commercial zinc finger nucleases for the research community, markets ...

Schering-Plough Announces U.S. Filing of Mometasone Furoate/Formoterol Fumarate Combination for the Maintenance Treatment of Asthma

... Inhaled steroids, including ASMANEX, may cause a reduction in growth velocity when administered to pediatric patients. The long-term effect on final adult height is unknown. Health care providers should closely follow the growth of children and adolescents taking corticosteroids by any route, an...

July 2009 Mayo Clinic Women's HealthSource Highlights Food Storage Safety, Energy Therapies and Vitamins and Minerals

...751. Foods may look, smell and even taste fine -- and still harbor bacteria that can cause food...nergy flow within and around the body. Some people find healing touch relaxing. There's little evidence ... or heart disease. That's just one of the research findings covered in the Special Report on Vitamins a...

July 2009 Mayo Clinic Health Letter Highlights a Positive Outlook, Bell's Palsy and Heart Valve Repair

...mprove health, decrease the risk of depression and increase longevity. The July issue of Mayo Clinic Health Letter highlights some studies and their findings. In a Mayo Clinic study, more than 7,000 people completed a personality test in the early 1960s, and researchers tracked participants ...

Swissmedic Grants Debiopharm Marketing Authorisation for Moapar(R), a New Therapeutic Avenue for the Treatment of Sexual Deviations

...yl(R)/Moapar(R) in nine major European countries, including France, Germany, the United Kingdom, Sweden, Norway, Denmark, Belgium, the Netherlands and finland. The product was launched earlier this year in Germany and Belgium. Initial contacts with potential distribution partners for the Swiss market ha...

Swissmedic Grants Debiopharm Marketing Authorisation for Moapar(R), a New Therapeutic Avenue for the Treatment of Sexual Deviations

...yl(R)/Moapar(R) in nine major European countries, including France, Germany, the United Kingdom, Sweden, Norway, Denmark, Belgium, the Netherlands and finland. The product was launched earlier this year in Germany and Belgium. Initial contacts with potential distribution partners for the Swiss market ha...

National Cancer Institute Research Identifies Unique Mechanism of Brostallicin's Anti-Tumor Effectiveness

...iology approach to drug development, combining pharmacogenomics and bioinformatics with experienced preclinical, clinical, and regulatory expertise to find and exploit a specific cancer's 'context of vulnerability.' Specifically, SM defines the molecular and genetic alterations (context) that cause canc...

Prospective Clinical Advantages of Trabecular Metal(TM) Technology Highlighted in Comparative Study

...rthopaedic surgeon at the Mayo Clinic and one of the study's authors. "Our findings confirmed initial assumptions that the low stiffness properties of th...ationships with customers and consultants, our market share and our overall financial performance; the success of our quality initiatives; the outcome o...
Other TagsplayersSolomonfilmfilmfilmfilmhonorhonorassistsforecast
(Date:11/24/2009)...el action of a remarkable class of ring-shaped pro... the Lawrence Berkeley National Laboratory (Berkel...graphy beamline at the Advanced Light Source (ALS)...expression and replication, and are vital to the s...ious agents, such as the human papillomavirus, whi...
(Date:11/24/2009)... (November 24, 2009) New research on bacterial co...tems reveals predictable temporal patterns, sugges...s markers for monitoring climate change in the pol... Proceedings of the National Academy of Sciences ... the six rivers shifted synchronously over time, c...
(Date:11/23/2009)...ember 23, 2009 - The time of day matters to forest...per produced by a research team led by Professor M...,s vice-principal for research and colleagues in t...t. George campus. , Capitalizing on their prev... the research team examined how poplar trees use t...
Breaking Biology News(10 mins):Atomic-level snapshot catches protein motor in action 2Atomic-level snapshot catches protein motor in action 3Atomic-level snapshot catches protein motor in action 4Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Time of day matters to thirsty trees, U of T researcher discovers 2Combo Treatment May Ease Depression After Stroke 53891 1Combo Treatment May Ease Depression After Stroke 53891 2Stroke Doubles Risk of Hip Thigh Fractures 53889 1Stroke Doubles Risk of Hip Thigh Fractures 53889 2Stroke Doubles Risk of Hip Thigh Fractures 53889 3Carnegie donates landmark clones to biology 9509 1Carnegie donates landmark clones to biology 9509 2
(Date:11/25/2009)....25/PRNewswire/-SentinelleMedicalInc.,aleadingmanu...ftwarelaunchesasuiteofnewleadingedgeclinicalapplic...atthisyear,sRadiologicalSocietyofNorthAmerica(RSNA...0,HallA).Theapplicationsleveragetheuniquehighquali...ngcoilsandsupportmultipleimagingmodalitiesformulti...
(Date:11/25/2009)...icalEndorsements,Business,andPressJoinEfforttoEduc...ire/--Onceagain,theNationalBipolarFoundationandthe...heir"Safe,tilStable"program,whichisnowbeingwidelya...order.Today,theNationalBipolarFoundationreceivedap...ailfromtheLt.GovernorofLouisianaMitchLandrieu.TheN...
(Date:11/25/2009)... period was too short to draw definite conclusions...HealthDay News) -- In diabetic patients with block...rence in outcomes at one year whether patients und...British researchers report. , Bypass surgery ha...s with coronary artery disease. However, less inva...
(Date:11/25/2009)...te, CDC sees few signs of trouble with the H1N1 va...y News) -- The ongoing H1N1 swine flu pandemic may... among younger patients, a U.S. health official sa...erious pneumococcal infections around the country,...er for Immunization and Respiratory Diseases at th...
(Date:11/25/2009)...eat colorectal cancer also can reverse a rare stom...herapy for the disease, researchers at Vanderbilt ...rier,s disease causes thickening of the stomach li...as well as anemia and swelling in the feet and ank... risk for gastric cancer. Previously, the only eff...
Breaking Medicine News(10 mins):Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 2Health News:Sentinelle Medical Launches Aegis Suite of Oncology 4D Visualization Software with PureWeb(TM) Technology 3Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 2Health News:First Time-Door is Open for Family Discussion of Bipolar Disorder 3Health News:Stenting May Equal Bypass for Diabetic Heart Patients 2Health News:Stenting May Equal Bypass for Diabetic Heart Patients 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 2Health News:Swine Flu Tied to Rise in Pneumonias Among Young 3Health News:Swine Flu Tied to Rise in Pneumonias Among Young 4Health News:Vanderbilt scientists report first effective medical therapy for rare stomach disorder 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmilia