Navigation Links


finder at medicine products

Pathfinder

Description:The pedicle screw insertion assembly incorporates slotted guides for easy rod insertion and construct locking. The PathFinder MIS System uses an ingenious technique in which the pedicle screw insertion assembly incorporates crescent-shaped slotted guides for easy rod insertion. The evolutionary Pathfinder MIS pedicle screw system uses small incisions for a less invasive technique....
Company:Abbott Spine

Pathfinder Rotavirus EIA

Description:Bio-Rad offers the Pathfinder Rotavirus EIA, a rapid and simple test for rotavirus infection which can significantly aid in patient management. The Pathfinder Rotavirus Enzyme Immunoassay Direct Antigen Detection System is for the diagnosis of rotavirus directly from patient specimens. This assay combines the specificity and reproducibiliy of monoclonal antibodies with the speed and efficiency...
Company:Bio-Rad Laboratories

Tractfinder® Closed Tip Ureteral Stents

Description:The silicone Tractfinder provides excellent fluoroscopic visualization. Manipulation of the movable core guidewire flexes the tapered proximal tip for maximum control in negotiating a tortuous ureter. Excellent for long-term patient comfort....
Company:GYRUS ACMI

Pathfinder Respiratory Syncytial Virus EIA

Description:Pathfinder RSV EIA Kit is a direct antigen detection system, that can use nasal washings or aspirates. It uses polyclonal and monoclonal antibodies to detect RSV directly in patient specimens. This assay combines the specificity and reproducibility of monoclonal antibodies with the speed and efficiency of an EIA. Qualitative results are availalbe within 90 minutes. The Pathfinder RSV EIA tes...
Company:Bio-Rad Laboratories

Pathfinder® Chlamydia DFA

Description:This direct fluorescent assays (DFA) kit uses a direct immunofluorescence technique to provide clear, easy-to-read and reliable results within 15 minutes. Chlamydia antigens are detected using a monoclonal antibody to the C. trachomatis major outer membrane protein (MOMP) that has been linked to fluorescein isothiocyanate....
Company:Bio-Rad Laboratories

Pathfinder Chlamydia Microplate (EIA Microplate)

Description:This EIA microplate opens new perspectives in the direct detection of Chlamydia. The choice of microplate immunoenzymatic technology and the use of a monoclonal antibody result in a combination of convenience and performance....
Company:Bio-Rad Laboratories

Pathfinder HSV 1 and 2 DFA

Description:The Pathfinder HSV 1 and 2 kit provides direct antigen detection and differentiation of Herpes Simplex Virus (HSV) Types 1 and 2. The monoclonal antibody-based test can be used to directly stain clinical specimens or tissue culture cells....
Company:Bio-Rad Laboratories

Pathfinder Chlamydia Culture Confirmation Test

Description:The Pathfinder Chlamydia Culture Confirmation provides clear and reliable staining of intracellular inclusions (elementary bodies and reticulate bodies) in tissue culture. The monoclonal antibody used in this kit is directed against the Chlamydia lipopolysaccharide....
Company:Bio-Rad Laboratories

ICD Finder

Description:A Palm Pilot and Desktop utility that you can use. Search for ICD codes in your office on your computer or in the field using your Palm Pilot....
Company:MAX Systems Inc.
Other TagsDECDECDECDECDECDECDECTWARTWARTWARTWARTWARpneumoniae
(Date:10/10/2008)...e Peninsula Medical School in Plymouth, UK, have c...moderate exercise a day recommended to children fr...rising problem of childhood obesity. , Their res...of the journal "Archives of Diseases in Childhood....hich has followed the development of over 200 chil...
(Date:10/10/2008)...ale scientists have created nanowire sensors coupl... both sensitive and specific enough to be used for...to a report in Nano Letters . , The sensors use...igens signatures of bacteria, viruses or cancer c... they produce acid, and generate a tiny current in...
(Date:10/10/2008)...rhood may make us all go a little gooey, but it,s ...ental health researchers at The Australian Nationa...re for Mental Health Research (CMHR) at ANU sugge...ancy affects their cognitive functions, there is n...ave been released as part of Mental Health Week, w...
(Date:10/9/2008)...ct. 9 /PRNewswire-FirstCall/ -- Aware, Inc. (Nasda...gy and biometrics software,has scheduled a confer...ts,for the third quarter of 2008 on Thursday, Octo...el Tzannes and CFO Rick Moberg will host the,earni...by Thomson and can be accessed on the,Investor Rel...
Breaking Biology News(10 mins):Recommendations for children's exercise lacking say experts 2Sensitive nanowire disease detectors made by Yale scientists 2Pregnancy not turning minds to mush: Study 2Aware Announces Q3 2008 Earnings Conference Call 2Drug Combo Halves Death Risk for Severe COPD Patients 8901 1Drug Combo Halves Death Risk for Severe COPD Patients 8901 2AlphaRx Officers and Directors To Exercise Options Warrants and Retain Shares 8896 1AlphaRx Officers and Directors To Exercise Options Warrants and Retain Shares 8896 2KV Pharmaceutical Company Announces NYSE Listing Extension 8891 1KV Pharmaceutical Company Announces NYSE Listing Extension 8891 2KV Pharmaceutical Company Announces NYSE Listing Extension 8891 3Maxygen to Present at the JPMorgan 26th Annual Healthcare Conference 2401 1
(Date:10/9/2008).../PRNewswire/ -- This may sound like,science fictio...onally,acclaimed anti-aging Doctor, Al Sears MD, h...e TA-65 to the public through his private practice...evolutionary technology that is based on telomere ...located at the ends of all the,chromosomes and in ...
(Date:10/9/2008)...ational Opportunities for Those on the ... 9 /PRNewswire/ -- In recognition of National,Cust...onors its more than,590 customer service represent... activities this week and celebrating those comple...than 4 million inquiries a year, IBC,s CSRs are mo...
(Date:10/9/2008)...wire/ -- Nature,s Way Holding Company, a,subsidiar...als, a leading,worldwide producer of clinically pr...ire all outstanding shares of Enzymatic Therapy wi...reholder of Enzymatic Therapy. The,agreement is su...tures and,provides for customary conditions to clo...
(Date:10/9/2008)...ire/ -- DogChannel.com, the premier,online destina...og Medical,Conditions section, where visitors can ...ugh a list of symptoms., The symptom list, locate...led by Dog Fancy,s "Ask the Vet" expert Karla Rugh...ontains the 40 most common signs of a,sick dog, fr...
Breaking Medicine News(10 mins):Health News:Science Fiction Has Become Reality with Remarkable Anti-Aging Treatment Breakthrough - Turning Back the Biological Clock in Aging 2Health News:Science Fiction Has Become Reality with Remarkable Anti-Aging Treatment Breakthrough - Turning Back the Biological Clock in Aging 3Health News:Independence Blue Cross Celebrates Customer Service Week 2Health News:Schwabe, World Leader in Herbal Manufacturing Will Acquire Enzymatic Therapy Through Nature's Way Holding, Inc. 2Health News:Schwabe, World Leader in Herbal Manufacturing Will Acquire Enzymatic Therapy Through Nature's Way Holding, Inc. 3Health News:DogChannel.com Launches Online Guide to Dog Medical Conditions 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria