Navigation Links


Invest at medicine news

Invest on gym memberships

Your attention please!! You will most probably get more benefit from investing in gymnasium membership and a exercise personal trainer than buying an machine. According to researchers at the Cleavland University // it is better to exercise at home or in the gym thatn to buy a machine Exercise machines are often advertised in a misleading way. For instance, they may need careful adjusting before t...

Investigations That Help Detect Lung Disease

COPD is a term to describe conditions such as chronic bronchitis and emphysema. It is characterized by obstruction of airflow // and gradual loss of lung function that cannot be corrected. The disease is the fourth leading cause of death in the United States. A test known as spirometry may significantly help physicians diagnose patients with chronic obstructive pulmonary disease earlier....

Sitagliptin, Under Investigation For Type 2 Diabetes

The number of people suffering from diabetes is already over 194 million worldwide and the number is expected to increase by 333 million by 2025. Type II diabetes is also known as non-insulin dependent diabetes // and is characterized by a relative disparity between endogenous insulin production and insulin requirements, leading to an elevated glucose. In contrast to Type I diabetes, there is alw...

Apollo Hospitals to invest Rs 350 cr to add 1,800 beds

Chennai-based Apollo Hospitals Group plans to invest Rs 350 crore to add 1,800 beds over the next 18 months. With the planned new addition of 1800 beds, Apollo Group's total capacity would touch 7,200 beds, from the current 6,400 beds. // "There is a plan for adding 800 beds through management of hospitals and another 1,000 beds from ownership,” says Apollo Hospitals Group Director Fin...

China Doubles Its Investment In AIDS/HIV Treatment.

The government of china in Beijing told the press that it has taken all possible measures to reduce the ever increasing number of HIV/AIDS infection in China. // It said that it is going to double the funds in the next two years allocated to keep in check the number of HIV positive people below 1.5 million by 2010. The money spent on this would be around $US 370. Chi...

Hospital kitchen food investigated for underfed patients

In a major allegation made by family of patients at Swansea psychiatric hospital, it is said that patients are not eating food. This is being linked with the closure of kitchens at Cefn Coed Hospital//. The claims made say that some elderly patients have lost weight following the closure of the kitchens at Cefn Coed Hospital. The closure of the kitchens occurred due to shi...

Biocon To Raise Its Investment In Scotland

Biocon, an Indian biotechnology company will raise its investments in Scotland which is seen to be an emerging destination for clinical development of drugs. Biocon is reported to already have // a close relationship with life sciences organizations in Scotland. There are more than 550 life sciences organizations in Scotland, employing more than 26,500 people. Scotland will serve to fill the ga...

Cocoa Treats: Chocolates, as a Health Investment? Chew on this!

This is some food for thought. A component of Cocoa is in the limelight for the right reasons. The component, called Flavanoids, known to stave off new age diseases like cancer and cardiovascular disease, can be used in medicines,// according to stalwarts from the food and industry department , though such medicines are still a distant dream. Flavonoids, is found in chocolates, gre...

President Bush Urges Citizens to Invest In Health Savings Account (HSAs)

In an attempt to manage the ever-increasing health care cost and increase the availability of medical insurance, the U.S. President, George W. Bush has urged the citizens to invest // in health saving accounts or HSAs that comprises of pretax dollars. At the time of need, the funds can be mobilized to pay for the medical expense. High deductible health insurance policies and lowest annu...

Doctor Accused Of Misdiagnosing 208 Patients: Further Investigation Ordered

An overseas-trained doctor, Farid Zaer, who has registered himself as a general practitioner in NSW has moved on to Queensland, to continue his medical practice.// The doctor has been prohibited from practicing elsewhere as he has been accused for wrong diagnosis involving nearly 208 patients. The doctor still holds the license to work as a GP, without any restriction or supervision....

Legionnaires Investigation in Chatswood's Shopping Area

Legionnaires' disease is caused by a bacteria belonging to the Legionella family, Legionella pneumophilia. // It has already infected two women one aged in her 50s and the other in her 70s. They were admitted in the Sydney's Royal North Shore Hospital. New South Wales (NSW) health officials are investigating an outbreak of Legionnaires' disease. Both said that they...

Researchers Investigate Protein that Protects Tumors

A protein that allows breast cancer cells to evade the body’s natural immune responses could be a target of future cancer therapies//, according to a study by Keck School of Medicine of USC scientists published today. The study, published in the July 1 issue of the American Journal of Pathology, is the first to identify how EphB4 – a protein that sits on the surface of cells – function...

New Multi-functional Sensing Tool To Investigate Cystic Fibrosis

A research team from Georgia Institute of Technology has developed a new multi-functional sensing system to investigate adenosine triposphate (ATP) release and its role in cystic fibrosis. // This patented technology adds recessed micro- and nano-electrodes to the tip of an atomic force microscope (AFM), creating a single tool that can simultaneously monitor topography along with ele...

Investigation to identify the source of HIV infection

The Kerala branch of the Indian Medical Association (IMA) urged the Government of India to order a detailed investigation into the source of HIV infection in Reshmi. // IMA state secretary R.Ramesh issued a press note saying that further scientific evaluation is necessary to allay the concerns over the safety of blood transfusion. Reshmi the two-year-old child died after a prolonged battle with t...

Investigation into the Poor Hospital Facility That Led To the Death of George Cook

The death of an elderly Nanaimo, B.C. man, George Cook father Cheryle Cook on a normal day resulted in an investigation has be launched against the hospital. His death was mainly because the delay in administering// proper treatment. It took seven hours before he was seen by a doctor who pronounced him dead. He died as he waited for emergency care. Cheryle Cook said that the 88-year-old...

WHO Officials Investigating Eight Suspected Bird Flu Cases

World Health Organization officials said yesterday that they were investigating eight suspected bird flu cases in humans in Sumatra//. Indonesian health officials said that four of these cases had been fatal. A team from the WHO had "checked the village and at this stage we can say they are still suspect at the moment," said Sari Setiogi, WHO spokeswoman in Indonesia. Nyoman Kandun,...

Varicose Vein Treatments Turn Out To Be A Viable Health Investment

Varicose vein treatments that are pretty much of a household therapy in the United Kingdom has been subject to analysis, //which has revealed that these therapies have added value to the life of the patients by drastically improving the quality of life. In that respect, United Kingdom is certainly better off with this health investment. “The conclusion is that if you look at varicose ve...

$5.5 Million Invested To Discourage Smoking in Public

$5.5 million is being invested by the Ontario government to prevent or reduce public smoking. This is another step to keep Ontario Smoke-Free. // Ontario officials said that this money would pay for 100 enforcement officers in the province. The act strictly prohibits people from smoking in workplaces and enclosed spaces which is common to public. In due course of time the officials thi...

Investigators Find Poisonous Chemicals In Four More Drugs In China

The authorities yesterday have announced that four more drugs made by a Heilongjiang Province drug maker in the center of a medical scandal are tainted with a poisonous industrial chemical. // It was found that patients receiving treatment in a local hospital in Guangzhou, capital city of south's China Guangdong province May 15, 2006 have shown symptoms of acute renal failure after h...

Health Expert Has Urged Public Sectors To Stop Investing In ITC

A leading health expert has urged all the public sector giants to dissociate themselves with the ITC.// On the occasion of 'World No Tobacco Day' today, he has pleaded the public sectors like Life Insurance Corporation of India (LIC), General Insurance Corporation and Unit Trust of India (UTI) to disinvest in Indian Tobacco Company (ITC). "The biggest stake holder in ITC is the British...

S.Africa Sets Up Task Team To Investigate Anthrax Outbreak In KNP

South African health authorities have set up a task team to investigate the outbreak of anthrax that has left 15 animals dead in the famous Kruger National Park (KNP) in the past few weeks //. The KNP spokesman Raymond Travers said on Monday that the team would decide on the course of action based on the evidence that they collect. The management of the park, KNP, is South Africa bigg...

MMR- Autism- Bowel Problems Connection To Be Investigated

Reports of suspected connection between MMR(measles, mumps and rubella) vaccine and bowel disorders and autism has created concern over the safety of the vaccine, despite the assurances extended by government experts and all the Royal Colleges //. An inquiry is to be initiated by the Department of Health, and tests are to be carried out on children whose families claim we...

Investigations Reveal That Infections Due To Contact lens Could Cause Blindness

An investigation has found that 200 people in the United States and the Far East who use contact //lenses have contracted an infection that could lead to blindness. Investigators have warned contact lens users about a new fungus infection called fusarium keratitis. This warning has lead to the withdrawal of one type of a lens cleaning solution that has been used by many of those affec...

IDFC Private Equity Invests Rs 90 Crore In Manipal Health Systems

Marking its first major investment into country's booming healthcare market, infrastructure investor IDFC today said it has placed a private equity placement of Rs 90 crore in Bangalore-based Manipal Health Systems // , acquiring a minority stake in the firm. The investment was made by IDFC Private Equity Fund II, a fund managed by IDFC Private Equity. "We have acquired a mi...

Investigation Launched Into Death Of Elderly Woman

The death of a 65-year-old woman at the Heatherside Hospital is being investigated by the Gardai. Ms Hannah Comber died //from asphyxiation after she apparently became caught in the straps of her special chair.The HSE said, it is fully co-operating with the investigation and will launch its own into the incident at a continuing care facility in Cork. The HSE added that the hospital has a safe...

Japanese Chemicals, Pharma Industry Keen to Invest in India

Japanese chemicals and pharmaceutical companies have evinced interest to invest in India with the likes of Mitsubishi Chemicals Co already committing Rs 1,665 crore investment for capacity expansion at its Haldia unit // , Union Chemicals and Fertilisers Minister Ram Vilas Paswan said here. The minister who led a delegation to Japan recently, said during his trip significant discussio...

GAO Investigation Questions Validity of DNA Testing Kits

Home DNA testing kits claiming to analyze consumers' DNA for genes which affect diseases like heart disease, cancer, or diabetes are misleading because they provide// results that are ambiguous, medically unproven, or both, according to federal investigators. These were the results from an investigation by the Government Accountability Office (GAO), which has led to a Senate hearing in...

India "Underinvesting" In Health Sector, Says Sachs

Jeffrey D Sachs, Director of the Earth Institute, Columbia University, a well-known economist feels that India must direct its attention towards Health Insurance Schemes// in order to provide better healthcare facilities for its citizens. "As part its National Health Mission, India should make a National Health Insurance scheme as one of its priority areas, with a large population of...

Dutch Pharma Firm to Invest $500 mn in India

DSM Anti-Infectives, a $20 billion pharma firm based in the Netherlands, Wednesday said it would invest $500 million in India and hoped to capture a 10 percent share of the// country's antibiotics market. "We are continuously exploring opportunities to invest in India. Currently, our sales in India is $100 million per annum," said company president Gerard Reuver, launching a new penic...

Health commission in a tight spot over delays in NHS complaints investigation

The BBC Radio 4 Today programme turned the spotlight on the healthcare commission, in charge of examining the complaints from patients about their experience with NHS//, which the commission has heavily fallen back on meeting the deadline. The Healthcare Commission has a huge pile of 3000 cases yet to investigated, which makes up almost 55% of the total number of complaints given to...

European Regulators Investigate Common Painkiller Drugs

European regulators are investigating common painkiller drugs after researchers warned that some of them might increase the risk of heart attack//. The new data, culled from 140,000 patients, suggested that some of the drugs doubled heart attack risk. The European Medicines Agency which is investigating drugs such as diclofenac, etodolac, ibuprofen, indomethacin, ketoprofe...

Investigating Alternatives for Childhood Depression

There’s a pressing need to assess the safety and effectiveness of commonly-used alternative therapies for depression among children and adolescents // , according to mental health experts from the University of Melbourne. Professor Anthony Jorm and colleagues have found that although alternative treatments for depression are in common use by young people, there’s little evidence of wh...

Health Officials Investigating Plausible Chikungunya Outbreak in Bengal villages

West Bengal- Four villages belonging to West Bengal’s North 24, parganas District, is reeling under the onslaught of a ‘puzzling’ fever, which has affected nearly 2000 people.// The symptoms point towards a possible Chikungunya outbreak. District Chief Medical Officer, Kusum Adhikari said, though the symptoms are very close to those of chikungunya, yet, doubts can be confirmed only a...

Assam Government to Invest Rs. 60 bn to Improve Healthcare Industry

Guwahati: The Assam government is to invest Rs.60 billion to upgrade its rundown medical colleges and recruit specialist doctors on high salaries to take on the challenge from the state's flourishing private healthcare industry.// "It is just a matter of time before the three medical colleges in Assam would give the private nursing homes and hospitals a real run for their money," Assa...

WHO calls for big investment in tests for TB

According to the World Health Organisation (WHO), shortage of adequate testing and diagnosis is the major reason for almost 9 million people getting affected by tuberculosis// every year. The United Nations agency called for huge investments for developing diagnostics in the low and middle-income countries, where 75% of the screening for TB takes place and around 1.7 million lives are...

Salmonella Outbreak under Investigation

Around 172 people in 18 states has been infected by a salmonella outbreak according to health officials on Monday.// These bacteria have been assumed to have spread through some form of produce including tomatoes. However the illness has not been linked to any specific product, chain, restaurants or supermarkets as yet. No deaths have occurred in the outbreak that is caused by...

Dr. Reddy's To Invest $100 Mn In Andhra

Indian pharma major Dr. Reddy's Laboratories (DRL) is all set to invest nearly Rs. 4.5 billion ($100 million) as part of their expansion drive in Andhra Pradesh, the company's home state. // 'As part of our plan, $100 million will be invested within the next 18 months for increasing our capacity in the field of formulations, Active Pharmaceuticals Ingredients (API) and Custom Pharmaceu...

US Biotech to Invest $400 Mn in Himachal Pradesh

Shimla: US-based Nanobiosym, a leading biotechnology firm, is keen to invest $400 million project in Himachal Pradesh to manufacture world-class equipment for a global market.// Anita Goel, founder and chief executive officer of Nanobiosym, submitted the project proposal to Chief Minister Virbhadra Singh over the weekend. "We have envisioned a project of over $400 million f...

Researchers Investigate Molecular Basis of Memory

Researchers from the European Molecular Biology Laboratory's (EMBL) Mouse Biology Unit in Monterotondo, Italy, and the Universidad Pablo de Olavide in Sevilla,// Spain, now for the first time investigate the molecular basis of memory in living mice. The study, which appears in the current issue of Learning and Memory, identified a molecule that is crucially involved in learning and singled out th...

Ontario Government Invests $200 Million on Colorectal Cancer Screening

Colorectal cancer is ranked second in the list of ‘deadliest’ cancers, which is a wake up call to evolve superior detection procedures to diagnose the disease in// the early stage. The Ontario government is investing a whopping $200 Million on a screening program for colorectal cancer. This plan will adopt two crucial approaches, targeting men above fifty years of age. The envisaged f...
Other TagsWorkersWorkersWorkersLohanSurfaceSurfaceSurfaceSurfaceSurface
(Date:10/10/2008)....- During the 1950s, Austrian and Swiss scientists... in Nepal taking photographs of the glaciers, moun... glaciologist Fritz Mller spent eight months in th...and photographing the Himalayan glaciers. , Now,...s taken by these scientists are of immense value i...
(Date:10/10/2008)...s available in German . , DNA, the molecule t...all forms of life, is highly resistant against alt...e mechanism for its photostability presents some p...between the four chemical bases that make up the D...ucceeded in showing that DNA strands differ in the...
(Date:10/9/2008)...Calif., Oct. 9 /PRNewswire-FirstCall/ -- Synaptics...oper of human interface,solutions for mobile compu...nnounced today that it will report financial resul...y, October 23, 2008 after the close of market. The... for analysts and,investors at 2:00 p.m. PT (5:00 ...
(Date:10/9/2008)...change exceed life,s ability to respond? Biodivers...008 issue of the journal, Science , illustrates t...ithsonian Tropical Research Institute in Panama cl...ly diverse region of rainforest and coral reefs, t...f global warming. Some disagree, arguing that trop...
Breaking Biology News(10 mins):'Himalaya -- Changing Landscapes' photo exhibition draws attention to the impacts of climate change 2'Himalaya -- Changing Landscapes' photo exhibition draws attention to the impacts of climate change 3Can genetic information be controlled by light? 2Synaptics to Report First Quarter Results on October 23 2Smithsonian perspective: Biodiversity in a warmer world 2St Jude Finds Link Between Cellular Defense Processes Showing How Cancer Cells Survive 8545 1St Jude Finds Link Between Cellular Defense Processes Showing How Cancer Cells Survive 8545 2SleepQuest Launches Updated Web Site 2301 1SleepQuest Launches Updated Web Site 2301 2Possible New Way to Detect Monitor Liver Disease Without Painful Liver Biopsy 2297 1Possible New Way to Detect Monitor Liver Disease Without Painful Liver Biopsy 2297 2Domestic violence identified as stressor associated with smoking 8541 1Domestic violence identified as stressor associated with smoking 8541 2
(Date:10/10/2008)...xcellence in the implementation of electronic heal...Management Systems Society (HIMSS) announces the r...ational, Ambulatory and Community Health Organizat..., IL (PRWEB) October 10, 2008 -- Honoring excellen...rds (EHRs), the Healthcare Information and Manage...
(Date:10/10/2008)...MC) has received a $5,807,469 grant over five year...nd the Boston Claude D. Pepper Older Americans Ind...ly 11 Pepper Centers in the country. , The Clau...rogram was established in honor of Claude D. Peppe...five decades of public service, Pepper was an advo...
(Date:10/10/2008)...e/ -- The Mobile Massage Team, (http://www.mobilem...ated massage,services for corporate wellness progr...unced today that it is expanding its service area ...iladelphia metropolitan region., "We are quite ex...,seated, massage programs and services throughout...
(Date:10/9/2008)...l Give Accredited Course for,Non-Dermatologists ab...eld November 1, 2008 at the Royal Sonesta Hotel Bo...wswire-USNewswire/ -- The Melanoma,Foundation of N...icine are,co-sponsoring an Accreditation Council f...update non-dermatologists on the detection and man...
Breaking Medicine News(10 mins):Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 2Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 3Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 4Health News:2008 HIMSS Davies Awards: Nation's Outstanding Healthcare Organizations Recognized 5Health News:Boston Medical Center receives $5.8m grant 2Health News:Mobile Massage Team Announces Expansion of On-Site Seated Massage Services Throughout Eastern Pennsylvania and the Greater Philadelphia Region 2Health News:Paul Sullivan's Legacy: An Early Warning Program for Detecting Melanoma Before It's Too Late 2
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria