top
Navigation Links
top at biology products
Epitope Peptide Microarray - Comprehensive Service from LC Sciences
Description:LC Sciences provides a comprehensive epitope analysis service utilizing high density peptide microarrays synthesized on Paraflo microfluidic chips for immunological studies, vaccine development, and biosensor development. This comprehensive service includes assistance with your sequence designs, binding assays using sample(s) provided by you, single or dual color detection of the binding using a...Company:LC Sciences
Custom Epitope Peptide Microarray from LC Sciences
Description:Microarrays designed for immunological studies, vaccine development, and biosensor development built on the flexible and powerful Paraflo microfluidic on-chip synthesis platform. These microarrays are available as part of our comprehensive Epitope Peptide Microarray Service. Probe content is completely customer specified. Screen your samples against thousands...Company:LC Sciences
Topoisomerase I from Invitrogen
Description:...Company:Invitrogen
Benchtop Laminar Hood (Universal Hood) from Terra Universal, Inc.
Description:This modular benchtop laminar flow hood forces air through a 99.99% efficient HEPA filter to create a clean processing area. Options include a work bench, ionizaing bar, and air velocity gauge....Company:Terra Universal, Inc.
Benchtop Laminar Flow Hood (Environmental Control Module) from Terra Universal, Inc.
Description:This modular laminar flow hood forces air through a 99.99% efficient HEPA filter to create a clean processing area. Configurations are available with vertical or horizontal flow; options include a work bench, ionizing bar and air velocity gauge....Company:Terra Universal, Inc.
Benchtop Ductless Exhaust Hood (Universal Hood) from Terra Universal, Inc.
Description:This modular benchtop fume hood ventilates and purifies chemical fumes, allowing safe indoor release of exhaust. Bonded charcoal filters remove most organic contaminants. Options include final HEPA filter, work bench and air velocity gauge....Company:Terra Universal, Inc.
Benchtop Ductless Exhaust Hood (Environmental Control Module) from Terra Universal, Inc.
Description:This modular benchtop fume hood ventilates and purifies chemical fumes, allowing safe indoor release of exhaust. Bonded charcoal filters remove most organic contaminants. Configurations are available with vertical or horizontal flow; options include final HEPA filter, work bench and air velocity gauge....Company:Terra Universal, Inc.
Benchtop Ductless Exhaust Fume Hood from Terra Universal, Inc.
Description:Ventilates and removes chemical fumes, allowing safe indoor release of exhaust. Bonded charcoal filters remove most organic contaminants. Dual impellers ensure safe exhaust flow speed = 100 fpm with 15" access opening. Includes air speed monitor, quick-release filter/blower modules and vapor-sealed illuminator....Company:Terra Universal, Inc.
Benchtop Laminar Hood (Universal Hood) from Terra Universal, Inc.
Description:...Company:Terra Universal, Inc.
Vaccinia DNA Topoisomerase I from EPICENTRE Biotechnologies
Description:Topoisomerase I from vaccinia virus is a type I eukaryotic topoisomerase that removes both positive and negative superhelical turns (also called right- and left-handed supercoils) from covalently closed DNA. The product of the reaction is a covalently closed, circular DNA with fewer positive or negative superhelical turns. DNA Topoisomerase I does not absolutely require Mg to functio...Company:EPICENTRE Biotechnologies
Vaccinia DNA Topoisomerase I from EPICENTRE Biotechnologies
Description:Topoisomerase I from vaccinia virus is a type I eukaryotic topoisomerase that removes both positive and negative superhelical turns (also called right- and left-handed supercoils) from covalently closed DNA. The product of the reaction is a covalently closed, circular DNA with fewer positive or negative superhelical turns. DNA Topoisomerase I does not absolutely require Mg to functio...Company:EPICENTRE Biotechnologies
Topoisomerase I from Invitrogen
Description:Topoisomerase I...Company:Invitrogen
Rat Anti-STENOTROPHOMONAS MALTOPHILIA Polyclonal Antibody, Unconjugated from AbD Serotec
Description:ANTI STENOTROPHOMONAS MALTOPHILIA...Company:AbD Serotec
Human Topoisomerase I Wild Type from Calbiochem
Description:Liquid. In 100 mM KCl, 20 mM Tris-HCl, 1 mM DTT, 200 µM EDTA, 20% glycerol, pH 7.9. AVOID FREEZE/THAW CYCLES. Human DNA topoisomerase I (Topo I) is a monomeric protein of 765 amino acids encoded by a single-copy gene. It catalyzes the relaxation of both positive and negative supercoiled DNAs without the requirement of energy. In addition to DNA replication...Company:Calbiochem
Human Topoisomerase II, Alpha from USB Corp.
Description:Source: E. coli containing a clone of the human Topoisomerase II gene. . As a result of its double-stranded DNA passage mechanism, the enzyme can relax negatively or positively supercoiled DNA, as well...Company:USB Corp.
Calf Topoisomerase I from USB Corp.
Description:Source: Calf thymus 2+</SUP...Company:USB Corp.
Human Topoisomerase II, Alpha from USB Corp.
Description:Source: E. coli containing a clone of the human Topoisomerase II gene. . As a result of its double-stranded DNA passage mechanism, the enzyme can relax negatively or positively supercoiled DNA, as well...Company:USB Corp.
MBS Thermal Cycler 2 Block Laptop Kit from Thermo Scientific
Description:2 Block MBS Start up kit. Includes configured Laptop PC with PCR authorized software and choice of 2 MultiBlock satellite thermal cyclers (non-robotic). System expandable to 30 blocks. User friendly software. Store/track run data. Gradient capability. Adjustable height heated lid. Outstanding uniformity. Advanced control algorithms for reduced reaction times....Company:Thermo ScientificDescription:Mouse Anti-Human Killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 4 (KIR2DL4 Monoclonal Antibody New...
Company:Lifespan Biosciences
Anti-Topoisomerase II (Ki-S1) Monoclonal Antibody, Unconjugated, Clone P-tyr-I from CHEMICON
Description:Topoisomerase II...Company:CHEMICON
Sheep Anti-Rabbit Tryptophan Hydroxylase Antibody, Unconjugated from ABR-Affinity BioReagents
Description:-20 C, Avoid Freeze/Thaw Cycles...Company:ABR-Affinity BioReagents
80C Tabletop Incubator Shaker, 90-125V, 50/60 Hz or 180-250V, 50/60 Hz from Thermo Scientific
Description:Forma Incubated Orbital Shakers combine high durability and capacity with unequalled temperature performance and ease of use. The patented triple-counterbalanced heavy-duty mechanism prevents vibration, allowing the unit to run at high speed with heavy, out-of-balance loads. The unit's class-leading temperature range is delivered with tight uniformity by twin blowers and an insulated cabinet. In...Company:Thermo Scientific
Tabletop Orbital Shaker, 90-126V, 50/60 Hz or 180-253V, 50/60 Hz from Thermo Scientific
Description:Forma Tabletop orbital shakers combine high durability and capacity with unequalled ease of use. The patented triple-counterbalanced heavy-duty mechanism prevents vibration, allowing the unit to run smoothly with heavy, out-of-balance loads. Every other part, from the large rubber block vibration isolator feet, to the thick machined aluminum platform is designed to last through years of non-stop...Company:Thermo Scientific
MBS Thermal Cycler 1 Block Laptop Kit from Thermo Scientific
Description:1 Block MBS Start up kit. Includes configured Laptop PC with PCR authorized software and choice of 1 MultiBlock satellite thermal Cycler (non-robotic). System expandable to 30 blocks. User friendly software. Store/track run data. Gradient capability. Adjustable height heated lid. Outstanding uniformity. Advanced control algorithms for reduced reaction times....Company:Thermo Scientific
Holten Maxi Safe 2010 Cabinet Model 1.5, with divided tabletop from Thermo Scientific
Description:The Holten MaxiSafe 2010 Class II Biological Safety Cabinets provide the most ergonomical working condition of comfort while incorporating the latest technology for safety, efficiency and performance.Refined operator, environment and product protection with dual filtration of both exhausted and recirculated air.Bottom filters are safely exchanged under laminar flow....Company:Thermo Scientific
Holten Safe 2010 Cabinet Model 0.9, with divided tabletop (230V / 50Hz) from Thermo Scientific
Description:The Holten Safe 2010 Class II Biological Safety Cabinets provide the most ergonomical working condition of comfort while incorporating the latest technology for safety, efficiency and performance....Company:Thermo ScientificDescription:Thermo Electron's CryoMed Freezers for IVF are designed for human in vitro fertiliaztion (K021042) with precise control, ease of setup and operation, and convenience. Chamber, sample temperature and operation status are continuously displayed on the control panel. Our signature graph and the cycle data are printed by way of the thermal printer inside the top of unit. These IVF models provide con...
Company:Thermo Scientific
ALTO-8 (Bench top Version) from ABgene
Description:Abgene's ALTO-8 is the first automated decapper/capper for Abgene Twist-Lock tubes....Company:ABgene
MitoPT Detection of Mitochondrial Permeability from B-Bridge International
Description:The MitoPT kit is used in conjunction with your existing apoptosis protocols. Grow your cells in culture and induce apoptosis according to your existing procedure (also reserve a non-induced population of cells as a negative control). Once you have induced apoptosis in your cells, add the 1X MitoPT solution to each population and incubate the cells for an additional 15 minutes. During this incuba...Company:B-Bridge International
PRO S-7C Stirrer, Ceramic Top, 115 V from PRO Scientific
Description:The PRO S-7 stirrers deliver accurate and repeatable results. Spill-resistant housing channels fluids away from internal components. The Front panel features easy-to-use controls which allow users to dial-in adjustments. 7"x7" ceramic tops feature a chemical resistant, reflective white top plate surface that's easy to clean....Company:PRO Scientific
Pyrex brand low actinic narrow mouth Erlenmeyer flask, Pyrex ST 27 stopper from Sigma-Aldrich
Description:capacity 250 mL...Company:Sigma-AldrichDescription:MAb to IgG2 (Fc gamma-2) IgG2 (Fc, gamma-2 epitope)...
Company:Meridian Life Science, Inc.Description:Mouse Anti-Human Killer Cell Immunoglobulin-like Receptor, Two Domains, Long Cytoplasmic Tail, 2 (KIR2DL2 (KIR2DL3 Monoclonal Antibody Flow Cytometry...
Company:Lifespan Biosciences
Positope Control Protein from Invitrogen
Description:...Company:Invitrogen
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Description:Mouse monoclonal antibody raised against a partial recombinant TOPORS. SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*...Company:Abnova CorporationDescription:Recognizes Human Connexin 45. Due to sequence homologies, this antibody is also expected to react with canine (100% homology) and mouse (92% homology) Connexin 45. Also confirmed to work on rat C6 cells. Others not tested....
Company:CHEMICON
Stopping Screens for PDS-1000 He and Hepta Systems, 500 from Bio-Rad
Description:These stopping screens are for the biolistic PDS-1000 He and Hepta systems. Supplied as 500 screens....Company:Bio-Rad
Stat-Matic I Plate Washer, Bottle-top dispenser from CHEMICON
Description:The StatMatic I provides a convenient and affordable alternative for diagnostic assays and cell culture work. Used with an eight-port disposable manifold, the StatMatic I provides continuous operation not possible with multi-channel pipettes. The eight-port manifold, designed for 96-well microplates, delivers fluids in volumes of 100, 200, 250, or 300mL with well-to-well accuracy of 5% or better....Company:CHEMICON
pLenti6/V5 Directional TOPO Cloning Kit from Invitrogen
Description:Normal;heading 1;heading 2;Many mammalian cell types and experimental situations create challenges for standard transfection and other viral transduction systems. ViraPower Lentiviral Expression System overcomes these challenges by efficiently transduci...Company:Invitrogen
Rabbit Anti-Mouse Junctophilin-2 (C-term) Monoclonal Antibody,, Clone ZMD.473 from Invitrogen
Description:Clone/PAD: ZMD.473. Immunogen: Synthetic peptide derived from the C-terminal region of the mouse junctophilin-2. Specificity: Specific for the junctophilin-2 protein. Reactivity: Mouse (positive controls: mouse skeletal muscle homogenates frozen mouse skeletal muscle tissues). Applications: Western blotting Immunohistochemistry(froz) ImmunofluorescenceStorage: Store at -20C for long-term stor...Company:Invitrogen
Other TagsWitnessesbrokebrokeOther Contentsmyopiamyopiamyopiamyositismyositismyringotomymyotonicnarcolepsynarcolepsycongestioncongestioncongestionmyxedemaabnormalitiesabnormalitiesabnormalitiesabnormalitiesabnormalitiesabnormalitiesabnormalitiesabnormalities
KiwiSnappishconsultancyAbsenteeismpossessionlegalizesCPIadministersWitnessesalarmsIntraperitonealdowngradingWaterbornebroke
(Date:7/25/2008)...25, 2008) New research published in the July issu...ons shows elevated plasma DNA is a reliable marke...uggests that plasma DNA levels rise before clinica... patients. , Esophageal cancer, one of the lea...diagnosed at a late stage. An accurate marker for ...
(Date:7/24/2008)...shortages and growing demand for bio-fuels and hyd... among the greatest threats today to the preservat...developers look for new areas for agriculture, ene...resisting pressures to convert wetlands is vital t... of services essential to humanity, including safe...
(Date:7/24/2008)...eroids bulk up plants just as they do human athlet...l the genes to boost growth and development in pla... animal cells. A new study by plant biologists at ...r approach called proteomics to identify key links... these plant hormones activate genes could lead no...
(Date:7/24/2008)...ed with a telescope promise to make it easier for ...activities requiring sharper distance vision. Sche...e advantages of these innovative glasses over earl...e issue of Journal of Biomedical Optics , mailed ...is new design has several advantages," says the in...
Breaking Biology News(10 mins):Plasma DNA level is a reliable marker of recurrent esophageal cancer, study finds 2Rising energy, food prices major threats to wetlands as farmers eye new areas for crops 2Rising energy, food prices major threats to wetlands as farmers eye new areas for crops 3Plant steroids offer new paradigm for how hormones work 2Plant steroids offer new paradigm for how hormones work 3Telescope embedded in glasses lens promises to make driving easier for visually impaired 2Telescope embedded in glasses lens promises to make driving easier for visually impaired 3Extra Pounds During 3Ci 3Eand Between 3C i 3E Pregnancies Can Pose Problems 17251 1Extra Pounds During 3Ci 3Eand Between 3C i 3E Pregnancies Can Pose Problems 17251 2Extra Pounds During 3Ci 3Eand Between 3C i 3E Pregnancies Can Pose Problems 17251 3DuoCort Hosts Adrenal Insufficiency Symposium at the 10th European Congress of Endocrinology in Berlin 4711 1DuoCort Hosts Adrenal Insufficiency Symposium at the 10th European Congress of Endocrinology in Berlin 4711 2BioMed Realty Trust to Report 2008 First Quarter Results 17249 1BioMed Realty Trust to Report 2008 First Quarter Results 17249 2Playtex 28R 29 Offers Free Non BPA Baby Bottles to Parents Will Stop Using BPA in All Products This Year 17248 1Playtex 28R 29 Offers Free Non BPA Baby Bottles to Parents Will Stop Using BPA in All Products This Year 17248 2[0] Plasma DNA level is a reliable marker of recurrent esophageal cancer, study finds[0] Rising energy, food prices major threats to wetlands as farmers eye new areas for crops[0] Plant steroids offer new paradigm for how hormones work[0] Telescope embedded in glasses lens promises to make driving easier for visually impaired
(Date:7/25/2008)...wswire/ -- Sagent Pharmaceuticals, Inc.,a private...nounced that it,has launched amiodarone HCl inject... the treatment and prophylaxis of frequently recur...unstable ventricular,tachycardia -- a potentially ...iodarone HCl injection will be available immediate...
(Date:7/25/2008)...gus can cause immune system changes , , ...ence linking gastroesophageal reflux disease (GERD...y Medical Center researchers. , An association ...1970s, and since then studies have shown that betw...lso experience GERD symptoms. But the actual link ...
(Date:7/25/2008)...ou are an Olympian, Professional Athlete, Elite Am...u Need to Know about Hydration to Boost Sports Per...r , Marina del Rey, Calif...tes are heading to Beijing following years of inte...pes of capturing an Olympic medal and securing the...
(Date:7/24/2008)...ers at Wake Forest University Baptist Medical Cent...that the hepatitis C virus slows or stunts the imm...atients are treated with a combination of drugs kn...ction is more serious in HIV-infected people, lead...s for Disease Control. Intravenous drug use is a m...
Breaking Medicine News(10 mins):Health News:Sagent Pharmaceuticals Launches Amiodarone HCl Injection, USP 2Health News:Sagent Pharmaceuticals Launches Amiodarone HCl Injection, USP 3Health News:People With GERD More Likely to Develop Asthma 2Health News:Hydration Will Be Key For Beijing Bound Olympians, What Every Athlete Must Know 2Health News:Hydration Will Be Key For Beijing Bound Olympians, What Every Athlete Must Know 3Health News:Hydration Will Be Key For Beijing Bound Olympians, What Every Athlete Must Know 4Health News:Hydration Will Be Key For Beijing Bound Olympians, What Every Athlete Must Know 5Health News:Researchers disprove long-standing belief about HIV treatment 2Health News:Researchers disprove long-standing belief about HIV treatment 3| Copyright © 2003-2008 Bio-Medicine. All rights reserved. ABOUT | CONTACT US | DISCLAIMER | PRIVACY POLICY | TERMS AND CONDITIONS |  |