Epitope Peptide Microarray - Comprehensive Service from LC Sciences
Description:LC Sciences provides a comprehensive epitope analysis service utilizing high density peptide microarrays synthesized on Paraflo microfluidic chips for immunological studies, vaccine development, and biosensor development. This comprehensive service includes assistance with your sequence designs, binding assays using sample(s) provided by you, single or dual color detection of the binding using a...Custom Epitope Peptide Microarray from LC Sciences
Description:Microarrays designed for immunological studies, vaccine development, and biosensor development built on the flexible and powerful Paraflo microfluidic on-chip synthesis platform. These microarrays are available as part of our comprehensive Epitope Peptide Microarray Service. Probe content is completely customer specified. Screen your samples against thousands...Topoisomerase I from Invitrogen
Description:...Benchtop Laminar Hood (Universal Hood) from Terra Universal, Inc.
Description:This modular benchtop laminar flow hood forces air through a 99.99% efficient HEPA filter to create a clean processing area. Options include a work bench, ionizaing bar, and air velocity gauge....Benchtop Laminar Flow Hood (Environmental Control Module) from Terra Universal, Inc.
Description:This modular laminar flow hood forces air through a 99.99% efficient HEPA filter to create a clean processing area. Configurations are available with vertical or horizontal flow; options include a work bench, ionizing bar and air velocity gauge....Benchtop Ductless Exhaust Hood (Universal Hood) from Terra Universal, Inc.
Description:This modular benchtop fume hood ventilates and purifies chemical fumes, allowing safe indoor release of exhaust. Bonded charcoal filters remove most organic contaminants. Options include final HEPA filter, work bench and air velocity gauge....Benchtop Ductless Exhaust Hood (Environmental Control Module) from Terra Universal, Inc.
Description:This modular benchtop fume hood ventilates and purifies chemical fumes, allowing safe indoor release of exhaust. Bonded charcoal filters remove most organic contaminants. Configurations are available with vertical or horizontal flow; options include final HEPA filter, work bench and air velocity gauge....Benchtop Ductless Exhaust Fume Hood from Terra Universal, Inc.
Description:Ventilates and removes chemical fumes, allowing safe indoor release of exhaust. Bonded charcoal filters remove most organic contaminants. Dual impellers ensure safe exhaust flow speed = 100 fpm with 15" access opening. Includes air speed monitor, quick-release filter/blower modules and vapor-sealed illuminator....Benchtop Laminar Hood (Universal Hood) from Terra Universal, Inc.
Description:...Vaccinia DNA Topoisomerase I from EPICENTRE Biotechnologies
Description:Topoisomerase I from vaccinia virus is a type I eukaryotic topoisomerase that removes both positive and negative superhelical turns (also called right- and left-handed supercoils) from covalently closed DNA. The product of the reaction is a covalently closed, circular DNA with fewer positive or negative superhelical turns. DNA Topoisomerase I does not absolutely require Mg to functio...Vaccinia DNA Topoisomerase I from EPICENTRE Biotechnologies
Description:Topoisomerase I from vaccinia virus is a type I eukaryotic topoisomerase that removes both positive and negative superhelical turns (also called right- and left-handed supercoils) from covalently closed DNA. The product of the reaction is a covalently closed, circular DNA with fewer positive or negative superhelical turns. DNA Topoisomerase I does not absolutely require Mg to functio...Topoisomerase I from Invitrogen
Description:Topoisomerase I...Rat Anti-STENOTROPHOMONAS MALTOPHILIA Polyclonal Antibody, Unconjugated from AbD Serotec
Description:ANTI STENOTROPHOMONAS MALTOPHILIA...Human Topoisomerase I Wild Type from Calbiochem
Description:Liquid. In 100 mM KCl, 20 mM Tris-HCl, 1 mM DTT, 200 µM EDTA, 20% glycerol, pH 7.9. AVOID FREEZE/THAW CYCLES. Human DNA topoisomerase I (Topo I) is a monomeric protein of 765 amino acids encoded by a single-copy gene. It catalyzes the relaxation of both positive and negative supercoiled DNAs without the requirement of energy. In addition to DNA replication...Human Topoisomerase II, Alpha from USB Corp.
Description:Source: E. coli containing a clone of the human Topoisomerase II gene. . As a result of its double-stranded DNA passage mechanism, the enzyme can relax negatively or positively supercoiled DNA, as well...Calf Topoisomerase I from USB Corp.
Description:Source: Calf thymus 2+</SUP...Human Topoisomerase II, Alpha from USB Corp.
Description:Source: E. coli containing a clone of the human Topoisomerase II gene. . As a result of its double-stranded DNA passage mechanism, the enzyme can relax negatively or positively supercoiled DNA, as well...MBS Thermal Cycler 2 Block Laptop Kit from Thermo Scientific
Description:2 Block MBS Start up kit. Includes configured Laptop PC with PCR authorized software and choice of 2 MultiBlock satellite thermal cyclers (non-robotic). System expandable to 30 blocks. User friendly software. Store/track run data. Gradient capability. Adjustable height heated lid. Outstanding uniformity. Advanced control algorithms for reduced reaction times....Anti-Topoisomerase II (Ki-S1) Monoclonal Antibody, Unconjugated, Clone P-tyr-I from CHEMICON
Description:Topoisomerase II...Sheep Anti-Rabbit Tryptophan Hydroxylase Antibody, Unconjugated from ABR-Affinity BioReagents
Description:-20 C, Avoid Freeze/Thaw Cycles...80C Tabletop Incubator Shaker, 90-125V, 50/60 Hz or 180-250V, 50/60 Hz from Thermo Scientific
Description:Forma Incubated Orbital Shakers combine high durability and capacity with unequalled temperature performance and ease of use. The patented triple-counterbalanced heavy-duty mechanism prevents vibration, allowing the unit to run at high speed with heavy, out-of-balance loads. The unit's class-leading temperature range is delivered with tight uniformity by twin blowers and an insulated cabinet. In...Tabletop Orbital Shaker, 90-126V, 50/60 Hz or 180-253V, 50/60 Hz from Thermo Scientific
Description:Forma Tabletop orbital shakers combine high durability and capacity with unequalled ease of use. The patented triple-counterbalanced heavy-duty mechanism prevents vibration, allowing the unit to run smoothly with heavy, out-of-balance loads. Every other part, from the large rubber block vibration isolator feet, to the thick machined aluminum platform is designed to last through years of non-stop...MBS Thermal Cycler 1 Block Laptop Kit from Thermo Scientific
Description:1 Block MBS Start up kit. Includes configured Laptop PC with PCR authorized software and choice of 1 MultiBlock satellite thermal Cycler (non-robotic). System expandable to 30 blocks. User friendly software. Store/track run data. Gradient capability. Adjustable height heated lid. Outstanding uniformity. Advanced control algorithms for reduced reaction times....Holten Maxi Safe 2010 Cabinet Model 1.5, with divided tabletop from Thermo Scientific
Description:The Holten MaxiSafe 2010 Class II Biological Safety Cabinets provide the most ergonomical working condition of comfort while incorporating the latest technology for safety, efficiency and performance.Refined operator, environment and product protection with dual filtration of both exhausted and recirculated air.Bottom filters are safely exchanged under laminar flow....Holten Safe 2010 Cabinet Model 0.9, with divided tabletop (230V / 50Hz) from Thermo Scientific
Description:The Holten Safe 2010 Class II Biological Safety Cabinets provide the most ergonomical working condition of comfort while incorporating the latest technology for safety, efficiency and performance....ALTO-8 (Bench top Version) from ABgene
Description:Abgene's ALTO-8 is the first automated decapper/capper for Abgene Twist-Lock tubes....MitoPT Detection of Mitochondrial Permeability from B-Bridge International
Description:The MitoPT kit is used in conjunction with your existing apoptosis protocols. Grow your cells in culture and induce apoptosis according to your existing procedure (also reserve a non-induced population of cells as a negative control). Once you have induced apoptosis in your cells, add the 1X MitoPT solution to each population and incubate the cells for an additional 15 minutes. During this incuba...PRO S-7C Stirrer, Ceramic Top, 115 V from PRO Scientific
Description:The PRO S-7 stirrers deliver accurate and repeatable results. Spill-resistant housing channels fluids away from internal components. The Front panel features easy-to-use controls which allow users to dial-in adjustments. 7"x7" ceramic tops feature a chemical resistant, reflective white top plate surface that's easy to clean....Pyrex brand low actinic narrow mouth Erlenmeyer flask, Pyrex ST 27 stopper from Sigma-Aldrich
Description:capacity 250 mL...Positope Control Protein from Invitrogen
Description:...Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Description:Mouse monoclonal antibody raised against a partial recombinant TOPORS. SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRTTT*...Stopping Screens for PDS-1000 He and Hepta Systems, 500 from Bio-Rad
Description:These stopping screens are for the biolistic PDS-1000 He and Hepta systems. Supplied as 500 screens....Stat-Matic I Plate Washer, Bottle-top dispenser from CHEMICON
Description:The StatMatic I provides a convenient and affordable alternative for diagnostic assays and cell culture work. Used with an eight-port disposable manifold, the StatMatic I provides continuous operation not possible with multi-channel pipettes. The eight-port manifold, designed for 96-well microplates, delivers fluids in volumes of 100, 200, 250, or 300mL with well-to-well accuracy of 5% or better....pLenti6/V5 Directional TOPO Cloning Kit from Invitrogen
Description:Normal;heading 1;heading 2;Many mammalian cell types and experimental situations create challenges for standard transfection and other viral transduction systems. ViraPower Lentiviral Expression System overcomes these challenges by efficiently transduci...Rabbit Anti-Mouse Junctophilin-2 (C-term) Monoclonal Antibody,, Clone ZMD.473 from Invitrogen
Description:Clone/PAD: ZMD.473. Immunogen: Synthetic peptide derived from the C-terminal region of the mouse junctophilin-2. Specificity: Specific for the junctophilin-2 protein. Reactivity: Mouse (positive controls: mouse skeletal muscle homogenates frozen mouse skeletal muscle tissues). Applications: Western blotting Immunohistochemistry(froz) ImmunofluorescenceStorage: Store at -20C for long-term stor...