Navigation Links
GST in Biological Products

Rabbit Anti-Occludin, C-Terminus Monoclonal Antibody, GST Conjugated, Clone PADZMD.544 from Invitrogen

Description: Rb anti-Occludin (C-term GST)...
Company:Invitrogen

pET GST Fusion System 41 from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...
Company:Novagen

pET GST Fusion System 41 plus Competent Cells from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...
Company:Novagen

pET GST Fusion System 42 from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...
Company:Novagen

pET GST Fusion System 42 plus Competent Cells from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...
Company:Novagen

Mouse Anti-Human PMM2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... PMM2 Immunogen: PMM2 (NP_000294, 47 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human PPOX Monoclonal Antibody, Unconjugated, Clone 2F10 from ABR-Affinity BioReagents

Description:... PPOX Immunogen: PPOX (AAH02357, 378 a.a. ~ 478 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human KRIT1 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... KRIT1 Immunogen: KRIT1 (NP_004903, 637 a.a. ~ 737 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human PURA Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... PURA Immunogen: PURA (NP_005850, 183 a.a. ~ 293 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human STX18 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... STX18 Immunogen: STX18 (NP_058626, 101 a.a. ~ 200 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human ANXA11 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... ANXA11 Immunogen: ANXA11 (NP_001148, 406 a.a. ~ 506 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human B3GALT2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... B3GALT2 Immunogen: B3GALT2 (NP_003774, 324 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human WASF2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... WASF2 Immunogen: WASF2 (NP_008921, 73 a.a. ~ 173 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human XPC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... XPC Immunogen: XPC (NP_004619, 141 a.a. ~ 251 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human HAMP Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... HAMP Immunogen: HAMP (AAH20612, 25 a.a. ~ 85 a.a) full length recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human HSD17B3 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... HSD17B3 Immunogen: HSD17B3 (NP_000188, 29 a.a. ~ 120 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human DDO Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... DDO Immunogen: DDO (NP_003640, 270 a.a. ~ 370 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human NANS Monoclonal Antibody, Unconjugated, Clone 3G6 from ABR-Affinity BioReagents

Description:... NANS Immunogen: NANS (NP_061819, 260 a.a. ~ 360 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Rabbit Anti-Human VEZT Polyclonal Antibody, Unconjugated from Abcam

Description:... Rabbit polyclonal to VEZT ( Abpromise for all tested applications). Antigen: Full length human VEZT conjugated to gst Entrez Gene ID: 55591 Swiss Protein ID: Q9HBM0...
Company:Abcam

Mouse Anti-Human AADAC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... AADAC Immunogen: AADAC (NP_001077, 201 a.a. ~ 301 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human XPMC2H Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... XPMC2H Immunogen: XPMC2H (NP_065118, 323 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human QPRT Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human QPRT Monoclonal Antibody, Unconjugated, Clone 5D11 from ABR-Affinity BioReagents

Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

GST Protein Active from BioVision

Description:... Active gst Protein...
Company:BioVision

Mouse Anti-PSD-95, PDZ Domain Monoclonal Antibody, Unconjugated, Clone K28/86.2 from Upstate

Description:... Anti-PSD-95, clone K28/86.2, PDZ Domain GenBank Accession Number : NM_007864 Immunogen : gst fusion to residues 77-299 of human-PSD-95 (PDZ Domain) Formulation: 0.01M Tris pH 7.4, 0.075M NaCl containing 0.05% sodium azide Quality Assurance: ro...
Company:Upstate

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description:... Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with gst tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLE...
Company:Abnova Corporation

Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...lyclonal antibody raised against a partial recombinant SLC22A3. Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with gst tag. Accession Number: NM_021977 Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*...
Company:Abnova Corporation

Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

Description:...monoclonal antibody raised against a partial recombinant TOPORS. Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with gst tag. Accession Number: NM_005802 Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRER...
Company:Abnova Corporation

Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

Description:... monoclonal antibody raised against a partial recombinant NFKBIB. Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with gst tag. Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 Prote...
Company:Abnova Corporation

Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...Mouse polyclonal antibody raised against a partial recombinant FES. Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with gst tag. Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVV...
Company:Abnova Corporation

Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:... polyclonal antibody raised against a partial recombinant PPP4C. Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with gst tag. Accession Number: NM_002720 Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*...
Company:Abnova Corporation

Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...e polyclonal antibody raised against a partial recombinant XAGE2. Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Accession Number: NM_130777 Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*...
Company:Abnova Corporation

Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...use polyclonal antibody raised against a partial recombinant ZFHX4. Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with gst tag. Accession Number: NM_024721 Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSL...
Company:Abnova Corporation

Mouse Anti-K6HF Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...se polyclonal antibody raised against a partial recombinant K6HF. Immunogen: K6HF (NP_004684, 141 a.a. ~ 241 a.a) partial recombinant protein with gst tag. Accession Number: NM_004693 Protein Sequence: TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDV...
Company:Abnova Corporation

Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

Description:...Mouse monoclonal antibody raised against a partial recombinant MAK. Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with gst tag. Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC03982...
Company:Abnova Corporation

Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:... polyclonal antibody raised against a partial recombinant SF3B2. Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with gst tag. Accession Number: NM_006842 Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*...
Company:Abnova Corporation

PolarScreen Androgen Receptor Competitor Assay Kit, Red from Molecular Probes (Invitrogen)

Description:...ing and screening potential AR ligands using fluorescence polarization (FP). The kits contain rat AR ligand binding domain protein tagged with His and gst [AR-LBD (His-GST)], and a novel, selective fluorescent androgen ligand (Fluormone AL Green in the green assay kit or Fluormone AL Red in the red assay...
Company:Molecular Probes (Invitrogen)

Glutathione-S-Transferase (GST) Colorimetric Assay Kit from Sigma-Aldrich

Description:... carcinogenic, and toxic effects of the compounds. gst activity is present in plants, insects, yeast, bac...ey role in detoxification General description: The gst Assay is intended for total gst activity measurement in cell and bacterial lysates...
Company:Sigma-Aldrich
Other Tags
(Date:7/31/2014)... noise alters how the brain processes speech, potentially ... to neuroscientists at The University of Texas at ... in Ear and Hearing , researchers demonstrated ... affects the brain,s recognition of speech sounds. , ... the population, affecting an estimated 15 percent of ...
(Date:7/31/2014)... Assistant Professor of Clinical Surgery at LSU Health Sciences ... a team of plastic and reconstructive surgeons who report ... and select patients for a specific surgical migraine treatment ... this surgery to decompress the nerves that trigger migraines ... surgery. The study, which confirms the benefit of surgical ...
(Date:7/31/2014)... SHELTON, Conn. , July 31, 2014 /PRNewswire/ ... on the growing m-commerce market, reminds investors and ... generation smart wallet, Wocket™, that it will be on-air ... biometrically secure Wocket smart wallet will be featured ... consumer oriented television show that airs on the ...
Breaking Biology News(10 mins):UT Dallas study reveals effect of loud noises on brain 2Surgeons report significant migraine relief from cosmetic eyelid surgery technique 2NXT-ID's Next Generation Biometric Smart Wallet Featured on NewsWatch Consumer Show on the History Channel and FYI Network Today, July 31st 2NXT-ID's Next Generation Biometric Smart Wallet Featured on NewsWatch Consumer Show on the History Channel and FYI Network Today, July 31st 3
(Date:8/1/2014)... (PRWEB) August 01, 2014 Narrow ... health plans and employers effective options to trim ... networks argue that they can enhance formulary compliance ... fees. Consultants report that nearly all PBMs now ... requests for proposals. The Aug. 12 webinar ...
(Date:8/1/2014)... Fitness is something most people can add to a ... block to biking ten or more miles, adding daily exercise ... the year. The Forbes Living talk show is ... special guests, tips to get started and cool products to ... air on most popular cable television networks. , About ...
(Date:8/1/2014)... CA (PRWEB) August 01, 2014 ... advancing gynecologic endoscopic surgery, is pleased to announce ... in the United States and Europe, which strongly ... available to surgeons an endoscopic dry lab for ... of their endoscopic surgery skills. , Endoscopy is ...
(Date:8/1/2014)... retailer Disposable Medical Express has announced that they will ... of Tranquility incontinence care products. The website carries Tranquility’s ... personal care products. , “We know how hard ... products that you love,” a said company representative. “So ... shouldn't have to compromise because of cost.” , ...
(Date:8/1/2014)... NY (PRWEB) August 01, 2014 Millions ... that affects the legs and in some cases the ... estimates state that about 17 million women in the ... of women dealing with the pain, embarrassment and discomfort ... and even some physicians are unaware that this is a ...
Breaking Medicine News(10 mins):Health News:Atlantic Information Services Webinar to Offer Health Plan, Employer Strategies for Implementing Narrow Pharma Networks 2Health News:Forbes Living to Air Fitness Forward Series 2Health News:AAGL Announces It Has Joined With Other Medical Societies to Encourage Hospitals Teaching Endoscopic Surgery to Establish Simulator Labs for Training 2Health News:Disposable Medical Express Offering Low Price Guarantee On Tranquility Products 2Health News:Lipedema Centers Works With Insurers To Gain Coverage For Lipedema Treatment 2
Other Contents