Navigation Links
GST in Biological Products
Description: Rb anti-Occludin (C-term GST)...
Company:Invitrogen
Company:Novagen
Company:Novagen
Company:Novagen
Company:Novagen
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:Abcam
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:ABR-Affinity BioReagents
Company:BioVision
Company:Upstate
Company:Abnova Corporation
Company:Abnova Corporation
Company:Abnova Corporation
Company:Abnova Corporation
Company:Abnova Corporation
Company:Abnova Corporation
Company:Abnova Corporation
Company:Abnova Corporation
Company:Abnova Corporation
Company:Abnova Corporation
Company:Abnova Corporation
Company:Molecular Probes (Invitrogen)
Company:Sigma-Aldrich
Company:Invitrogen
pET GST Fusion System 41 from Novagen
Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...Company:Novagen
pET GST Fusion System 41 plus Competent Cells from Novagen
Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...Company:Novagen
pET GST Fusion System 42 from Novagen
Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...Company:Novagen
pET GST Fusion System 42 plus Competent Cells from Novagen
Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...Company:Novagen
Mouse Anti-Human PMM2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... PMM2 Immunogen: PMM2 (NP_000294, 47 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human PPOX Monoclonal Antibody, Unconjugated, Clone 2F10 from ABR-Affinity BioReagents
Description:... PPOX Immunogen: PPOX (AAH02357, 378 a.a. ~ 478 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human KRIT1 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... KRIT1 Immunogen: KRIT1 (NP_004903, 637 a.a. ~ 737 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human PURA Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... PURA Immunogen: PURA (NP_005850, 183 a.a. ~ 293 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human STX18 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... STX18 Immunogen: STX18 (NP_058626, 101 a.a. ~ 200 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human ANXA11 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... ANXA11 Immunogen: ANXA11 (NP_001148, 406 a.a. ~ 506 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human B3GALT2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... B3GALT2 Immunogen: B3GALT2 (NP_003774, 324 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human WASF2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... WASF2 Immunogen: WASF2 (NP_008921, 73 a.a. ~ 173 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human XPC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... XPC Immunogen: XPC (NP_004619, 141 a.a. ~ 251 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human HAMP Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... HAMP Immunogen: HAMP (AAH20612, 25 a.a. ~ 85 a.a) full length recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human HSD17B3 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... HSD17B3 Immunogen: HSD17B3 (NP_000188, 29 a.a. ~ 120 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human DDO Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... DDO Immunogen: DDO (NP_003640, 270 a.a. ~ 370 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human NANS Monoclonal Antibody, Unconjugated, Clone 3G6 from ABR-Affinity BioReagents
Description:... NANS Immunogen: NANS (NP_061819, 260 a.a. ~ 360 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Rabbit Anti-Human VEZT Polyclonal Antibody, Unconjugated from Abcam
Description:... Rabbit polyclonal to VEZT ( Abpromise for all tested applications). Antigen: Full length human VEZT conjugated to gst Entrez Gene ID: 55591 Swiss Protein ID: Q9HBM0...Company:Abcam
Mouse Anti-Human AADAC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... AADAC Immunogen: AADAC (NP_001077, 201 a.a. ~ 301 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human XPMC2H Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... XPMC2H Immunogen: XPMC2H (NP_065118, 323 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human QPRT Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents
Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
Mouse Anti-Human QPRT Monoclonal Antibody, Unconjugated, Clone 5D11 from ABR-Affinity BioReagents
Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...Company:ABR-Affinity BioReagents
GST Protein Active from BioVision
Description:... Active gst Protein...Company:BioVision
Mouse Anti-PSD-95, PDZ Domain Monoclonal Antibody, Unconjugated, Clone K28/86.2 from Upstate
Description:... Anti-PSD-95, clone K28/86.2, PDZ Domain GenBank Accession Number : NM_007864 Immunogen : gst fusion to residues 77-299 of human-PSD-95 (PDZ Domain) Formulation: 0.01M Tris pH 7.4, 0.075M NaCl containing 0.05% sodium azide Quality Assurance: ro...Company:Upstate
Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation
Description:... Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with gst tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLE...Company:Abnova Corporation
Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation
Description:...lyclonal antibody raised against a partial recombinant SLC22A3. Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with gst tag. Accession Number: NM_021977 Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*...Company:Abnova Corporation
Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation
Description:...monoclonal antibody raised against a partial recombinant TOPORS. Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with gst tag. Accession Number: NM_005802 Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRER...Company:Abnova Corporation
Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation
Description:... monoclonal antibody raised against a partial recombinant NFKBIB. Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with gst tag. Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 Prote...Company:Abnova Corporation
Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation
Description:...Mouse polyclonal antibody raised against a partial recombinant FES. Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with gst tag. Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVV...Company:Abnova Corporation
Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation
Description:... polyclonal antibody raised against a partial recombinant PPP4C. Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with gst tag. Accession Number: NM_002720 Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*...Company:Abnova Corporation
Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Description:...e polyclonal antibody raised against a partial recombinant XAGE2. Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Accession Number: NM_130777 Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*...Company:Abnova Corporation
Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation
Description:...use polyclonal antibody raised against a partial recombinant ZFHX4. Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with gst tag. Accession Number: NM_024721 Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSL...Company:Abnova Corporation
Mouse Anti-K6HF Polyclonal Antibody, Unconjugated from Abnova Corporation
Description:...se polyclonal antibody raised against a partial recombinant K6HF. Immunogen: K6HF (NP_004684, 141 a.a. ~ 241 a.a) partial recombinant protein with gst tag. Accession Number: NM_004693 Protein Sequence: TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDV...Company:Abnova Corporation
Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation
Description:...Mouse monoclonal antibody raised against a partial recombinant MAK. Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with gst tag. Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC03982...Company:Abnova Corporation
Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation
Description:... polyclonal antibody raised against a partial recombinant SF3B2. Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with gst tag. Accession Number: NM_006842 Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*...Company:Abnova Corporation
PolarScreen Androgen Receptor Competitor Assay Kit, Red from Molecular Probes (Invitrogen)
Description:...ing and screening potential AR ligands using fluorescence polarization (FP). The kits contain rat AR ligand binding domain protein tagged with His and gst [AR-LBD (His-GST)], and a novel, selective fluorescent androgen ligand (Fluormone AL Green in the green assay kit or Fluormone AL Red in the red assay...Company:Molecular Probes (Invitrogen)
Glutathione-S-Transferase (GST) Colorimetric Assay Kit from Sigma-Aldrich
Description:... carcinogenic, and toxic effects of the compounds. gst activity is present in plants, insects, yeast, bac...ey role in detoxification General description: The gst Assay is intended for total gst activity measurement in cell and bacterial lysates...Company:Sigma-Aldrich
Other TagsOther Contents
LaveranInhibitoryRecurOrthCMEAnalogsCatastropheADBKazirangadrunkseagullCapecitabineSurroundingSaviour
(Date:5/17/2013)... of proteins in the brain responsible for protecting nerve ... could increase cell survival. , The discovery, made by ... in the EMBO journal with additional comment ... for stroke and other brain diseases. , The research ... a protein, known as SUMO, responsible for controlling the ...
(Date:5/17/2013)... of American Societies for Experimental Biology (FASEB) released a ... (NIH) funding trends highlighting the devastating impact of sequestration ... FASEB analysis follows a May 15th Senate Appropriations Committee ... testified that the $1.6 billion cut the agency sustained ... substantial impact on the scientific community." , According ...
(Date:5/16/2013)... FASEB MARC (Maximizing Access to Research Careers) Program ... Society for Developmental Biology (SDB) 72nd Annual Meeting ... awards are meant to promote the entry of ... the mainstream of the basic science community and ... the SDB 2013 Annual Meeting. , Awards are ...
Breaking Biology News(10 mins):SUMO wrestling cells reveal new protective mechanism target for stroke 2(Date:5/18/2013)... Regular consumption of coffee is associated with a ... autoimmune liver disease, Mayo Clinic research shows. The ... Week 2013 conference in Orlando, Fla. , ... ducts that results in inflammation and subsequent fibrosis ... liver failure and biliary cancer. , "While rare, ...
(Date:5/18/2013)... 18, 2013 Transvaginal mesh lawsuits ... to move forward in a consolidated litigation underway in ... reports. According to a notice on the Court’s website, ... mesh litigation will be held on Wednesday, May 22nd. ... filed in the proceeding on behalf of women who ...
(Date:5/18/2013)... (PRWEB) May 18, 2013 TheBeautyPlace.com answers ... Pattern hair loss is not a result of stress, ... to Men’s Fitness Magazine, 70% of men suffer from ... Strength is renowned for hair transplant surgery, but ... male pattern baldness known as Bosley Professional Strength. Their ...
(Date:5/18/2013)... Simple changes in a person’s every day routine, ... water can lead to substantial health benefits, the proven ... Diet Doc understands that overcoming significant weight ... difficult and often requires the use of prescription strength ... get over initial weight loss hurdles. In addition to ...
(Date:5/18/2013)... Mexico, DF (PRWEB) May 18, 2013 ... by leading ayurvedic education institution in the West. Program ... Learning education. , Ayurveda is a healing modality practiced ... Ayurvedica ), it is considered that health begins when ... a profound understanding of their individual needs. Ayurveda aims ...
Breaking Medicine News(10 mins):Health News:Transvaginal Mesh Lawsuits: Bernstein Liebhard LLP Notes Upcoming Case Management Conference in New Jersey Ethicon Pelvic Mesh Litigation 2Health News:Transvaginal Mesh Lawsuits: Bernstein Liebhard LLP Notes Upcoming Case Management Conference in New Jersey Ethicon Pelvic Mesh Litigation 3Health News:TheBeautyPlace.com Features the Two New Best-Selling Hairloss Products: Bosley Professional Strength and Nioxin Systems 2Health News:TheBeautyPlace.com Features the Two New Best-Selling Hairloss Products: Bosley Professional Strength and Nioxin Systems 3Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 2Health News:hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments 3Health News:Ayurveda Training in Mexico Offered by Escuela de Ayurveda de California, a Leading Institution in the West 2[0] Consuming coffee linked to lower risk of detrimental liver disease, Mayo Clinic finds[0] Transvaginal Mesh Lawsuits: Bernstein Liebhard LLP Notes Upcoming Case Management Conference in New Jersey Ethicon Pelvic Mesh Litigation[0] TheBeautyPlace.com Features the Two New Best-Selling Hairloss Products: Bosley Professional Strength and Nioxin Systems[0] hCGTreatments / Diet Doc hCG Diets & Weight Loss Plans Announce the Best Weight Loss Through New Whole Foods, Healthy Snacks and Prescription Strength hCG Treatments[0] Ayurveda Training in Mexico Offered by Escuela de Ayurveda de California, a Leading Institution in the West
| Copyright © 2003-2012 Bio-Medicine. All rights reserved. ABOUT | CONTACT US | DISCLAIMER | PRIVACY POLICY | TERMS AND CONDITIONS |  |