Navigation Links
GST in Biological Products

Rabbit Anti-Occludin, C-Terminus Monoclonal Antibody, GST Conjugated, Clone PADZMD.544 from Invitrogen

Description: Rb anti-Occludin (C-term GST)...
Company:Invitrogen

pET GST Fusion System 41 from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...
Company:Novagen

pET GST Fusion System 41 plus Competent Cells from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...
Company:Novagen

pET GST Fusion System 42 from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...
Company:Novagen

pET GST Fusion System 42 plus Competent Cells from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...
Company:Novagen

Mouse Anti-Human PMM2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... PMM2 Immunogen: PMM2 (NP_000294, 47 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human PPOX Monoclonal Antibody, Unconjugated, Clone 2F10 from ABR-Affinity BioReagents

Description:... PPOX Immunogen: PPOX (AAH02357, 378 a.a. ~ 478 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human KRIT1 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... KRIT1 Immunogen: KRIT1 (NP_004903, 637 a.a. ~ 737 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human PURA Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... PURA Immunogen: PURA (NP_005850, 183 a.a. ~ 293 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human STX18 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... STX18 Immunogen: STX18 (NP_058626, 101 a.a. ~ 200 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human ANXA11 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... ANXA11 Immunogen: ANXA11 (NP_001148, 406 a.a. ~ 506 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human B3GALT2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... B3GALT2 Immunogen: B3GALT2 (NP_003774, 324 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human WASF2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... WASF2 Immunogen: WASF2 (NP_008921, 73 a.a. ~ 173 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human XPC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... XPC Immunogen: XPC (NP_004619, 141 a.a. ~ 251 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human HAMP Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... HAMP Immunogen: HAMP (AAH20612, 25 a.a. ~ 85 a.a) full length recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human HSD17B3 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... HSD17B3 Immunogen: HSD17B3 (NP_000188, 29 a.a. ~ 120 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human DDO Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... DDO Immunogen: DDO (NP_003640, 270 a.a. ~ 370 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human NANS Monoclonal Antibody, Unconjugated, Clone 3G6 from ABR-Affinity BioReagents

Description:... NANS Immunogen: NANS (NP_061819, 260 a.a. ~ 360 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Rabbit Anti-Human VEZT Polyclonal Antibody, Unconjugated from Abcam

Description:... Rabbit polyclonal to VEZT ( Abpromise for all tested applications). Antigen: Full length human VEZT conjugated to gst Entrez Gene ID: 55591 Swiss Protein ID: Q9HBM0...
Company:Abcam

Mouse Anti-Human AADAC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... AADAC Immunogen: AADAC (NP_001077, 201 a.a. ~ 301 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human XPMC2H Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... XPMC2H Immunogen: XPMC2H (NP_065118, 323 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human QPRT Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human QPRT Monoclonal Antibody, Unconjugated, Clone 5D11 from ABR-Affinity BioReagents

Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

GST Protein Active from BioVision

Description:... Active gst Protein...
Company:BioVision

Mouse Anti-PSD-95, PDZ Domain Monoclonal Antibody, Unconjugated, Clone K28/86.2 from Upstate

Description:... Anti-PSD-95, clone K28/86.2, PDZ Domain GenBank Accession Number : NM_007864 Immunogen : gst fusion to residues 77-299 of human-PSD-95 (PDZ Domain) Formulation: 0.01M Tris pH 7.4, 0.075M NaCl containing 0.05% sodium azide Quality Assurance: ro...
Company:Upstate

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description:... Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with gst tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLE...
Company:Abnova Corporation

Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...lyclonal antibody raised against a partial recombinant SLC22A3. Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with gst tag. Accession Number: NM_021977 Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*...
Company:Abnova Corporation

Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

Description:...monoclonal antibody raised against a partial recombinant TOPORS. Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with gst tag. Accession Number: NM_005802 Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRER...
Company:Abnova Corporation

Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

Description:... monoclonal antibody raised against a partial recombinant NFKBIB. Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with gst tag. Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 Prote...
Company:Abnova Corporation

Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...Mouse polyclonal antibody raised against a partial recombinant FES. Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with gst tag. Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVV...
Company:Abnova Corporation

Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:... polyclonal antibody raised against a partial recombinant PPP4C. Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with gst tag. Accession Number: NM_002720 Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*...
Company:Abnova Corporation

Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...e polyclonal antibody raised against a partial recombinant XAGE2. Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Accession Number: NM_130777 Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*...
Company:Abnova Corporation

Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...use polyclonal antibody raised against a partial recombinant ZFHX4. Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with gst tag. Accession Number: NM_024721 Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSL...
Company:Abnova Corporation

Mouse Anti-K6HF Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...se polyclonal antibody raised against a partial recombinant K6HF. Immunogen: K6HF (NP_004684, 141 a.a. ~ 241 a.a) partial recombinant protein with gst tag. Accession Number: NM_004693 Protein Sequence: TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDV...
Company:Abnova Corporation

Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

Description:...Mouse monoclonal antibody raised against a partial recombinant MAK. Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with gst tag. Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC03982...
Company:Abnova Corporation

Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:... polyclonal antibody raised against a partial recombinant SF3B2. Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with gst tag. Accession Number: NM_006842 Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*...
Company:Abnova Corporation

PolarScreen Androgen Receptor Competitor Assay Kit, Red from Molecular Probes (Invitrogen)

Description:...ing and screening potential AR ligands using fluorescence polarization (FP). The kits contain rat AR ligand binding domain protein tagged with His and gst [AR-LBD (His-GST)], and a novel, selective fluorescent androgen ligand (Fluormone AL Green in the green assay kit or Fluormone AL Red in the red assay...
Company:Molecular Probes (Invitrogen)

Glutathione-S-Transferase (GST) Colorimetric Assay Kit from Sigma-Aldrich

Description:... carcinogenic, and toxic effects of the compounds. gst activity is present in plants, insects, yeast, bac...ey role in detoxification General description: The gst Assay is intended for total gst activity measurement in cell and bacterial lysates...
Company:Sigma-Aldrich
Other Tags
(Date:7/24/2014)... The University of Texas Health Science Center at Houston ... help Harris County residents whose vision problems cannot be ... corrective lenses, many people with low vision can see ... low vision devices, such as telescopes, magnifiers and electronic ... is using the three-year, $164,645 SightFirst grant from the ...
(Date:7/24/2014)... (July 24, 2014) For years, researchers and patients ... nearly any cell type in the bodycould provide insight ... them. Yet progress has been hampered by the inability ... to their human counterparts, in part because human ESCs ... cells. , Now Thorold Theunissen, Benjamin Powell, and Haoyi ...
(Date:7/24/2014)... of fires covered central Africa in mid-July 2014, as ... red hotspots, which indicate areas of increased temperatures, are ... Democratic Republic of the Congo (northeast), and Zambia (southeast). ... and in some areas, especially in the Democratic Republic ... the south. , The fire season is an annual ...
Breaking Biology News(10 mins):UTHealth Dr. Bhavani Iyer awarded low vision grant 2Whitehead Institute researchers create 'naïve' pluripotent human embryonic stem cells 2
(Date:7/25/2014)... Mahendra Trivedi and his wife Dahryn Trivedi ... Power’ on Saturday, July 26, 2014. People from all ... transforming event as they will get a chance to ... are left for the commencement of this rare event. ... Dahryn Trivedi (his wife) and Alice Branton will provide ...
(Date:7/25/2014)... Yisrayl Hawkins, Pastor and Overseer of The ... the pot by revealing to the whole world, including even ... Satan, the devil, in his new article. , Yisrayl says ... and carried out by the Catholic Church. He says this ... Inspired Holy Scriptures and replacing it with titles such as ...
(Date:7/25/2014)... Recently, the largest herpes dating website ... that there had been a large increase in the number ... Living with a sexually transmitted disease can be difficult, but ... from all around the world who manage to go on ... many STDs including HSV, HPV, HIV, chlamydia, thrush, syphilis, hepatitis, ...
(Date:7/25/2014)... As the category creator and world leader in healthy chocolate, ... and improve individual lives worldwide through its exclusive and healthy ... successful Austin, Texas based "Xocai Activ Drink" author, is scheduled ... to promote the up and coming mxicorp.com/company/igc Eric Worre engagement ... been a leader in the Network Marketing Profession for over ...
(Date:7/24/2014)... Lawrence, KS (PRWEB) July 25, 2014 ... implant can be affected by the width of the ... to hold the implant. A variety of methods exist, ... and subsequent augmentation techniques. The ridge-split graft is highlighted ... , The Journal of Oral Implantology offers a ...
Breaking Medicine News(10 mins):Health News:Mahendra Trivedi to Host an Online Workshop ‘Consciousness is Power’ 2Health News:Mahendra Trivedi to Host an Online Workshop ‘Consciousness is Power’ 3Health News:Yisrayl Hawkins Says You Have Been Tricked Into Worshipping Satan in New Article 2Health News:The Number of People Living With HSV and HPV Greatly Increased- Survey on PositiveSingles.com 2Health News:Austin, Texas Based "Xocai Activ Drink" Author, Adam Paul Green, to Visit Niigata Japan to Promote mxicorp.com/company/igc Eric Worre Speaking Engagement 2Health News:Austin, Texas Based "Xocai Activ Drink" Author, Adam Paul Green, to Visit Niigata Japan to Promote mxicorp.com/company/igc Eric Worre Speaking Engagement 3Health News:Austin, Texas Based "Xocai Activ Drink" Author, Adam Paul Green, to Visit Niigata Japan to Promote mxicorp.com/company/igc Eric Worre Speaking Engagement 4Health News:A Comparison of Graft Techniques for the Alveolar Ridge Prior to Oral Implant 2Health News:A Comparison of Graft Techniques for the Alveolar Ridge Prior to Oral Implant 3
Other Contents