Navigation Links
GST in Biological Products

Rabbit Anti-Occludin, C-Terminus Monoclonal Antibody, GST Conjugated, Clone PADZMD.544 from Invitrogen

Description: Rb anti-Occludin (C-term GST)...
Company:Invitrogen

pET GST Fusion System 41 from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...
Company:Novagen

pET GST Fusion System 41 plus Competent Cells from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...
Company:Novagen

pET GST Fusion System 42 from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...
Company:Novagen

pET GST Fusion System 42 plus Competent Cells from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...
Company:Novagen

Mouse Anti-Human PMM2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... PMM2 Immunogen: PMM2 (NP_000294, 47 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human PPOX Monoclonal Antibody, Unconjugated, Clone 2F10 from ABR-Affinity BioReagents

Description:... PPOX Immunogen: PPOX (AAH02357, 378 a.a. ~ 478 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human KRIT1 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... KRIT1 Immunogen: KRIT1 (NP_004903, 637 a.a. ~ 737 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human PURA Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... PURA Immunogen: PURA (NP_005850, 183 a.a. ~ 293 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human STX18 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... STX18 Immunogen: STX18 (NP_058626, 101 a.a. ~ 200 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human ANXA11 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... ANXA11 Immunogen: ANXA11 (NP_001148, 406 a.a. ~ 506 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human B3GALT2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... B3GALT2 Immunogen: B3GALT2 (NP_003774, 324 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human WASF2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... WASF2 Immunogen: WASF2 (NP_008921, 73 a.a. ~ 173 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human XPC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... XPC Immunogen: XPC (NP_004619, 141 a.a. ~ 251 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human HAMP Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... HAMP Immunogen: HAMP (AAH20612, 25 a.a. ~ 85 a.a) full length recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human HSD17B3 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... HSD17B3 Immunogen: HSD17B3 (NP_000188, 29 a.a. ~ 120 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human DDO Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... DDO Immunogen: DDO (NP_003640, 270 a.a. ~ 370 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human NANS Monoclonal Antibody, Unconjugated, Clone 3G6 from ABR-Affinity BioReagents

Description:... NANS Immunogen: NANS (NP_061819, 260 a.a. ~ 360 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Rabbit Anti-Human VEZT Polyclonal Antibody, Unconjugated from Abcam

Description:... Rabbit polyclonal to VEZT ( Abpromise for all tested applications). Antigen: Full length human VEZT conjugated to gst Entrez Gene ID: 55591 Swiss Protein ID: Q9HBM0...
Company:Abcam

Mouse Anti-Human AADAC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... AADAC Immunogen: AADAC (NP_001077, 201 a.a. ~ 301 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human XPMC2H Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... XPMC2H Immunogen: XPMC2H (NP_065118, 323 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human QPRT Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human QPRT Monoclonal Antibody, Unconjugated, Clone 5D11 from ABR-Affinity BioReagents

Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

GST Protein Active from BioVision

Description:... Active gst Protein...
Company:BioVision

Mouse Anti-PSD-95, PDZ Domain Monoclonal Antibody, Unconjugated, Clone K28/86.2 from Upstate

Description:... Anti-PSD-95, clone K28/86.2, PDZ Domain GenBank Accession Number : NM_007864 Immunogen : gst fusion to residues 77-299 of human-PSD-95 (PDZ Domain) Formulation: 0.01M Tris pH 7.4, 0.075M NaCl containing 0.05% sodium azide Quality Assurance: ro...
Company:Upstate

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description:... Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with gst tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLE...
Company:Abnova Corporation

Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...lyclonal antibody raised against a partial recombinant SLC22A3. Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with gst tag. Accession Number: NM_021977 Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*...
Company:Abnova Corporation

Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

Description:...monoclonal antibody raised against a partial recombinant TOPORS. Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with gst tag. Accession Number: NM_005802 Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRER...
Company:Abnova Corporation

Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

Description:... monoclonal antibody raised against a partial recombinant NFKBIB. Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with gst tag. Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 Prote...
Company:Abnova Corporation

Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...Mouse polyclonal antibody raised against a partial recombinant FES. Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with gst tag. Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVV...
Company:Abnova Corporation

Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:... polyclonal antibody raised against a partial recombinant PPP4C. Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with gst tag. Accession Number: NM_002720 Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*...
Company:Abnova Corporation

Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...e polyclonal antibody raised against a partial recombinant XAGE2. Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Accession Number: NM_130777 Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*...
Company:Abnova Corporation

Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...use polyclonal antibody raised against a partial recombinant ZFHX4. Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with gst tag. Accession Number: NM_024721 Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSL...
Company:Abnova Corporation

Mouse Anti-K6HF Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...se polyclonal antibody raised against a partial recombinant K6HF. Immunogen: K6HF (NP_004684, 141 a.a. ~ 241 a.a) partial recombinant protein with gst tag. Accession Number: NM_004693 Protein Sequence: TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDV...
Company:Abnova Corporation

Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

Description:...Mouse monoclonal antibody raised against a partial recombinant MAK. Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with gst tag. Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC03982...
Company:Abnova Corporation

Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:... polyclonal antibody raised against a partial recombinant SF3B2. Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with gst tag. Accession Number: NM_006842 Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*...
Company:Abnova Corporation

PolarScreen Androgen Receptor Competitor Assay Kit, Red from Molecular Probes (Invitrogen)

Description:...ing and screening potential AR ligands using fluorescence polarization (FP). The kits contain rat AR ligand binding domain protein tagged with His and gst [AR-LBD (His-GST)], and a novel, selective fluorescent androgen ligand (Fluormone AL Green in the green assay kit or Fluormone AL Red in the red assay...
Company:Molecular Probes (Invitrogen)

Glutathione-S-Transferase (GST) Colorimetric Assay Kit from Sigma-Aldrich

Description:... carcinogenic, and toxic effects of the compounds. gst activity is present in plants, insects, yeast, bac...ey role in detoxification General description: The gst Assay is intended for total gst activity measurement in cell and bacterial lysates...
Company:Sigma-Aldrich
Other Tags
(Date:3/17/2015)... March 17, 2015 Emotient, the leader ... today announced general availability of Emotient Analytics ... the analysis of facial expressions. The system analyzes ... content, products and services. It delivers audience response ... sentiment - as derived from facial evidence of ...
(Date:3/12/2015)... FAIRFAX, Va. , March 12, 2015 ... company and a member of the Texas Instruments Design ... Chandrababu Naidu has demonstrated its IriShield USB MK2120U ... iris scanning facility for pension distribution. ... and assembled to be marketed in India ...
(Date:3/12/2015)... , March 12, 2015 WHEN:Tuesday, March 17, ... here: http://bit.ly/1G7Os0L . SPEAKERS: , Frost & ... - http://photos.prnewswire.com/prnh/20150311/181111 Biometric companies ... compete in several different markets and industries. This ... witnessing an uptrend. Join Frost ...
Breaking Biology News(10 mins):New Emotient Web Service Measures Audience Response Using On-Demand Facial Expression Analysis 2New Emotient Web Service Measures Audience Response Using On-Demand Facial Expression Analysis 3New Emotient Web Service Measures Audience Response Using On-Demand Facial Expression Analysis 4Indian States See IriTech's Scanner Bolstering Efficiency of Authentication for Aadhaar 2Indian States See IriTech's Scanner Bolstering Efficiency of Authentication for Aadhaar 3Biometrics Key to Future Growth in Healthcare, Retail and Financial Markets 2Biometrics Key to Future Growth in Healthcare, Retail and Financial Markets 3
(Date:3/26/2015)... (PRWEB) March 26, 2015 Saving Moses ... where it is most needed but least available. As ... milk to six clinics in the Benguela province of ... malnutrition. During a recent visit to their clinics, staff ... the mothers and their babies in a nation the ...
(Date:3/26/2015)... (PRWEB) March 26, 2015 The ... 30th “Introduction to Hyperbaric Medicine” course, which is ... Society (UHMS) and the National Board of Diving ... the 40-hour course 4 times a year at ... the NY tri-state region; registration is available on-line ...
(Date:3/26/2015)... Altamonte Springs, FL (PRWEB) March 26, 2015 ... one of the nation’s leading innovative specialty pharmacies, ... newly created position of Vice President of Pharmaceutical ... for fostering beneficial connections with our pharmaceuticals partners ... pharmaceutical relationships in support of BioPlus’ expansion. ...
(Date:3/26/2015)... 2015 The Pulmonary Hypertension ... to Treatments Act (PATA) that was introduced in ... David B. McKinley (R-WV) and Lois Capps (D-CA). ... for medications placed in a specialty tier and ... out-of-pocket expenses. , This legislation is critical to ...
(Date:3/26/2015)... 26, 2015 Documentation topped the ... and Assisted Living facilities during 2014, despite the ... the year. The survey queried Administrators, Directors ... coordinators, CNA’s and the variety of other interested ... website ( http://www.harmony-healthcare.com ) or participate in the ...
Breaking Medicine News(10 mins):Health News:Saving Moses Utilized Photography in an Effort to Engage Mothers and Their Babies on a Recent Visit to Angola 2Health News:The Life Support Technologies Group (LST) Conducted its 30th Accredited “Introduction to Hyperbaric Medicine” Course for Health Care Professionals 2Health News:The Life Support Technologies Group (LST) Conducted its 30th Accredited “Introduction to Hyperbaric Medicine” Course for Health Care Professionals 3Health News:The Life Support Technologies Group (LST) Conducted its 30th Accredited “Introduction to Hyperbaric Medicine” Course for Health Care Professionals 4Health News:BioPlus Specialty Pharmacy Expands Executive Team with New Position, Naming Sharon Ferrer as Vice President of Pharmaceutical Relations 2Health News:Pulmonary Hypertension Association Part of Coalition Supporting the Patients’ Access to Treatments Act 2Health News:Harmony Healthcare International Releases 2015 Post Acute Care Trends Report 2Health News:Harmony Healthcare International Releases 2015 Post Acute Care Trends Report 3
Other Contents