Navigation Links
GST in Biological Products

Rabbit Anti-Occludin, C-Terminus Monoclonal Antibody, GST Conjugated, Clone PADZMD.544 from Invitrogen

Description: Rb anti-Occludin (C-term GST)...
Company:Invitrogen

pET GST Fusion System 41 from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...
Company:Novagen

pET GST Fusion System 41 plus Competent Cells from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...
Company:Novagen

pET GST Fusion System 42 from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...
Company:Novagen

pET GST Fusion System 42 plus Competent Cells from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...
Company:Novagen

Mouse Anti-Human PMM2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... PMM2 Immunogen: PMM2 (NP_000294, 47 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human PPOX Monoclonal Antibody, Unconjugated, Clone 2F10 from ABR-Affinity BioReagents

Description:... PPOX Immunogen: PPOX (AAH02357, 378 a.a. ~ 478 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human KRIT1 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... KRIT1 Immunogen: KRIT1 (NP_004903, 637 a.a. ~ 737 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human PURA Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... PURA Immunogen: PURA (NP_005850, 183 a.a. ~ 293 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human STX18 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... STX18 Immunogen: STX18 (NP_058626, 101 a.a. ~ 200 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human ANXA11 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... ANXA11 Immunogen: ANXA11 (NP_001148, 406 a.a. ~ 506 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human B3GALT2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... B3GALT2 Immunogen: B3GALT2 (NP_003774, 324 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human WASF2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... WASF2 Immunogen: WASF2 (NP_008921, 73 a.a. ~ 173 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human XPC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... XPC Immunogen: XPC (NP_004619, 141 a.a. ~ 251 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human HAMP Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... HAMP Immunogen: HAMP (AAH20612, 25 a.a. ~ 85 a.a) full length recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human HSD17B3 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... HSD17B3 Immunogen: HSD17B3 (NP_000188, 29 a.a. ~ 120 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human DDO Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... DDO Immunogen: DDO (NP_003640, 270 a.a. ~ 370 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human NANS Monoclonal Antibody, Unconjugated, Clone 3G6 from ABR-Affinity BioReagents

Description:... NANS Immunogen: NANS (NP_061819, 260 a.a. ~ 360 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Rabbit Anti-Human VEZT Polyclonal Antibody, Unconjugated from Abcam

Description:... Rabbit polyclonal to VEZT ( Abpromise for all tested applications). Antigen: Full length human VEZT conjugated to gst Entrez Gene ID: 55591 Swiss Protein ID: Q9HBM0...
Company:Abcam

Mouse Anti-Human AADAC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... AADAC Immunogen: AADAC (NP_001077, 201 a.a. ~ 301 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human XPMC2H Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... XPMC2H Immunogen: XPMC2H (NP_065118, 323 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human QPRT Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human QPRT Monoclonal Antibody, Unconjugated, Clone 5D11 from ABR-Affinity BioReagents

Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

GST Protein Active from BioVision

Description:... Active gst Protein...
Company:BioVision

Mouse Anti-PSD-95, PDZ Domain Monoclonal Antibody, Unconjugated, Clone K28/86.2 from Upstate

Description:... Anti-PSD-95, clone K28/86.2, PDZ Domain GenBank Accession Number : NM_007864 Immunogen : gst fusion to residues 77-299 of human-PSD-95 (PDZ Domain) Formulation: 0.01M Tris pH 7.4, 0.075M NaCl containing 0.05% sodium azide Quality Assurance: ro...
Company:Upstate

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description:... Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with gst tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLE...
Company:Abnova Corporation

Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...lyclonal antibody raised against a partial recombinant SLC22A3. Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with gst tag. Accession Number: NM_021977 Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*...
Company:Abnova Corporation

Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

Description:...monoclonal antibody raised against a partial recombinant TOPORS. Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with gst tag. Accession Number: NM_005802 Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRER...
Company:Abnova Corporation

Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

Description:... monoclonal antibody raised against a partial recombinant NFKBIB. Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with gst tag. Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 Prote...
Company:Abnova Corporation

Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...Mouse polyclonal antibody raised against a partial recombinant FES. Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with gst tag. Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVV...
Company:Abnova Corporation

Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:... polyclonal antibody raised against a partial recombinant PPP4C. Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with gst tag. Accession Number: NM_002720 Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*...
Company:Abnova Corporation

Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...e polyclonal antibody raised against a partial recombinant XAGE2. Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Accession Number: NM_130777 Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*...
Company:Abnova Corporation

Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...use polyclonal antibody raised against a partial recombinant ZFHX4. Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with gst tag. Accession Number: NM_024721 Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSL...
Company:Abnova Corporation

Mouse Anti-K6HF Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...se polyclonal antibody raised against a partial recombinant K6HF. Immunogen: K6HF (NP_004684, 141 a.a. ~ 241 a.a) partial recombinant protein with gst tag. Accession Number: NM_004693 Protein Sequence: TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDV...
Company:Abnova Corporation

Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

Description:...Mouse monoclonal antibody raised against a partial recombinant MAK. Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with gst tag. Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC03982...
Company:Abnova Corporation

Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:... polyclonal antibody raised against a partial recombinant SF3B2. Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with gst tag. Accession Number: NM_006842 Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*...
Company:Abnova Corporation

PolarScreen Androgen Receptor Competitor Assay Kit, Red from Molecular Probes (Invitrogen)

Description:...ing and screening potential AR ligands using fluorescence polarization (FP). The kits contain rat AR ligand binding domain protein tagged with His and gst [AR-LBD (His-GST)], and a novel, selective fluorescent androgen ligand (Fluormone AL Green in the green assay kit or Fluormone AL Red in the red assay...
Company:Molecular Probes (Invitrogen)

Glutathione-S-Transferase (GST) Colorimetric Assay Kit from Sigma-Aldrich

Description:... carcinogenic, and toxic effects of the compounds. gst activity is present in plants, insects, yeast, bac...ey role in detoxification General description: The gst Assay is intended for total gst activity measurement in cell and bacterial lysates...
Company:Sigma-Aldrich
Other Tags
(Date:7/9/2014)... the bladders of healthy women differ from bacteria ... according to researchers from Loyola University Chicago Stritch ... July 9, 2014, in the American Society for ... bacterial communities may play a role in female ... a common, yet poorly understood, condition with symptoms ...
(Date:7/9/2014)... associate professor of plant pathology and microbiology ... the 2014 Alexopoulos Prize by the Mycological ... the science of mycology the study of fungi ... plant pathogens, and medically important fungi. , The award ... mycologist. Stajich received the award last month in East ...
(Date:7/9/2014)... As climate change shifts the geographic ranges in which ... it has on their parasites. Does an increased range ... as well? , Not necessarily, says a team of ... Armand Kuris. In a study published in the ... that for some species, the opposite may happen: Hosts ...
Breaking Biology News(10 mins):UC Riverside plant pathologist receives national recognition 2Not at home on the range 2Not at home on the range 3Not at home on the range 4
(Date:7/10/2014)... who experience hot flashes are unlikely to talk much ... silent suffering if they are willing to try ... University case study., After seven weeks of hypnotic relaxation ... following prostate cancer surgery showed a drastic decrease not ... in sleep quality, according to the study., The Baylor ...
(Date:7/9/2014)... 2014 -- The World Health Organization recommends that youth ... to vigorous physical activity (MVPA) each day. Studies ... during school hours. Therefore, it stands to reason ... MVPA. In a new study scheduled for publication ... that time spent outdoors after school was positively associated ...
(Date:7/9/2014)... 10, 2014 For the first time, researchers have ... population in Canada uses health care. A new study, ... clearly demonstrate the unique challenges faced by urban Aboriginal ... Michael,s Hospital. , The findings, published today in ... First Nations individuals and the general population. , Researchers ...
(Date:7/9/2014)... of Medicine at the University of Pennsylvania in collaboration ... $8 million grant from the National Cancer Institute (NCI) ... in patients with malignant pleural mesothelioma, a rare, aggressive ... the lining of the lungs and is caused almost ... a clinical trial and additional studies looking at the ...
(Date:7/9/2014)... in almost all types of cancer sends the protein ... fuel a tumour,s uncontrolled growth, new research suggests. , ... a molecular trigger responsible for ratcheting up activity of ... makes the building blocks cancer cells need to keep ... called SREBP, controls the flow of messages to the ...
Breaking Medicine News(10 mins):Health News:Men's hot flashes: Hypnotic relaxation may ease the discomfort men don't talk about 2Health News:Men's hot flashes: Hypnotic relaxation may ease the discomfort men don't talk about 3Health News:Men's hot flashes: Hypnotic relaxation may ease the discomfort men don't talk about 4Health News:Go play outside! Outdoor time promotes physical activity in youth 2Health News:Urban Aboriginal people face unique health challenges 2Health News:Penn mesothelioma program receives $8 million NCI grant 2Health News:Signal may send cancer's cellular factories into overdrive 2
Other Contents