Navigation Links
GST in Biological Products

Rabbit Anti-Occludin, C-Terminus Monoclonal Antibody, GST Conjugated, Clone PADZMD.544 from Invitrogen

Description: Rb anti-Occludin (C-term GST)...
Company:Invitrogen

pET GST Fusion System 41 from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...
Company:Novagen

pET GST Fusion System 41 plus Competent Cells from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GS...
Company:Novagen

pET GST Fusion System 42 from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...
Company:Novagen

pET GST Fusion System 42 plus Competent Cells from Novagen

Description: Schistosomal glutathione-S-transferase (GST) is commonly used as a fusion partner when expressing proteins in E. coli (1). The GSTTag sequence has been reported to enhance the production and in some cases the solubility of its fusion partners. When expressed in a soluble, properly folded form, GSTT...
Company:Novagen

Mouse Anti-Human PMM2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... PMM2 Immunogen: PMM2 (NP_000294, 47 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human PPOX Monoclonal Antibody, Unconjugated, Clone 2F10 from ABR-Affinity BioReagents

Description:... PPOX Immunogen: PPOX (AAH02357, 378 a.a. ~ 478 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human KRIT1 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... KRIT1 Immunogen: KRIT1 (NP_004903, 637 a.a. ~ 737 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human PURA Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... PURA Immunogen: PURA (NP_005850, 183 a.a. ~ 293 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human STX18 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... STX18 Immunogen: STX18 (NP_058626, 101 a.a. ~ 200 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human ANXA11 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... ANXA11 Immunogen: ANXA11 (NP_001148, 406 a.a. ~ 506 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human B3GALT2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... B3GALT2 Immunogen: B3GALT2 (NP_003774, 324 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human WASF2 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... WASF2 Immunogen: WASF2 (NP_008921, 73 a.a. ~ 173 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human XPC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... XPC Immunogen: XPC (NP_004619, 141 a.a. ~ 251 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human HAMP Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... HAMP Immunogen: HAMP (AAH20612, 25 a.a. ~ 85 a.a) full length recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human HSD17B3 Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... HSD17B3 Immunogen: HSD17B3 (NP_000188, 29 a.a. ~ 120 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human DDO Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... DDO Immunogen: DDO (NP_003640, 270 a.a. ~ 370 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human NANS Monoclonal Antibody, Unconjugated, Clone 3G6 from ABR-Affinity BioReagents

Description:... NANS Immunogen: NANS (NP_061819, 260 a.a. ~ 360 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Rabbit Anti-Human VEZT Polyclonal Antibody, Unconjugated from Abcam

Description:... Rabbit polyclonal to VEZT ( Abpromise for all tested applications). Antigen: Full length human VEZT conjugated to gst Entrez Gene ID: 55591 Swiss Protein ID: Q9HBM0...
Company:Abcam

Mouse Anti-Human AADAC Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... AADAC Immunogen: AADAC (NP_001077, 201 a.a. ~ 301 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human XPMC2H Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... XPMC2H Immunogen: XPMC2H (NP_065118, 323 a.a. ~ 423 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human QPRT Polyclonal Antibody, Unconjugated from ABR-Affinity BioReagents

Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

Mouse Anti-Human QPRT Monoclonal Antibody, Unconjugated, Clone 5D11 from ABR-Affinity BioReagents

Description:... QPRT Immunogen: QPRT (NP_055113, 198 a.a. ~ 298 a.a) partial recombinant protein with gst tag. Storage: -20 C, Avoid Freeze/Thaw Cycles *Available for distribution in the US only...
Company:ABR-Affinity BioReagents

GST Protein Active from BioVision

Description:... Active gst Protein...
Company:BioVision

Mouse Anti-PSD-95, PDZ Domain Monoclonal Antibody, Unconjugated, Clone K28/86.2 from Upstate

Description:... Anti-PSD-95, clone K28/86.2, PDZ Domain GenBank Accession Number : NM_007864 Immunogen : gst fusion to residues 77-299 of human-PSD-95 (PDZ Domain) Formulation: 0.01M Tris pH 7.4, 0.075M NaCl containing 0.05% sodium azide Quality Assurance: ro...
Company:Upstate

Mouse Anti-HD Monoclonal Antibody, Unconjugated, Clone 3D6 from Abnova Corporation

Description:... Mouse monoclonal antibody raised against a partial recombinant HD. Immunogen: HD (NP_002102, 81 a.a. ~ 191 a.a) partial recombinant protein with gst tag. Accession Number: NM_002111 Protein Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLE...
Company:Abnova Corporation

Mouse Anti-SLC22A3 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...lyclonal antibody raised against a partial recombinant SLC22A3. Immunogen: SLC22A3 (NP_068812, 90 a.a. ~ 156 a.a) partial recombinant protein with gst tag. Accession Number: NM_021977 Protein Sequence: CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLD*...
Company:Abnova Corporation

Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation

Description:...monoclonal antibody raised against a partial recombinant TOPORS. Immunogen: TOPORS (NP_005793, 98 a.a. ~ 206 a.a) partial recombinant protein with gst tag. Accession Number: NM_005802 Protein Sequence: SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRER...
Company:Abnova Corporation

Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation

Description:... monoclonal antibody raised against a partial recombinant NFKBIB. Immunogen: NFKBIB (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant protein with gst tag. Protein Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 Prote...
Company:Abnova Corporation

Mouse Anti-FES Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...Mouse polyclonal antibody raised against a partial recombinant FES. Immunogen: FES (AAH35357, 120 a.a. ~ 250 a.a) partial recombinant protein with gst tag. Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVV...
Company:Abnova Corporation

Mouse Anti-PPP4C Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:... polyclonal antibody raised against a partial recombinant PPP4C. Immunogen: PPP4C (NP_002711, 218 a.a. ~ 308 a.a) partial recombinant protein with gst tag. Accession Number: NM_002720 Protein Sequence: GSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL*...
Company:Abnova Corporation

Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...e polyclonal antibody raised against a partial recombinant XAGE2. Immunogen: XAGE2 (NP_570133, 44 a.a. ~ 112 a.a) partial recombinant protein with gst tag. Accession Number: NM_130777 Protein Sequence: RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*...
Company:Abnova Corporation

Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...use polyclonal antibody raised against a partial recombinant ZFHX4. Immunogen: ZFHX4 (NP_078997, 2 a.a. ~ 94 a.a) partial recombinant protein with gst tag. Accession Number: NM_024721 Protein Sequence: ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSL...
Company:Abnova Corporation

Mouse Anti-K6HF Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:...se polyclonal antibody raised against a partial recombinant K6HF. Immunogen: K6HF (NP_004684, 141 a.a. ~ 241 a.a) partial recombinant protein with gst tag. Accession Number: NM_004693 Protein Sequence: TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDV...
Company:Abnova Corporation

Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

Description:...Mouse monoclonal antibody raised against a partial recombinant MAK. Immunogen: MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with gst tag. Protein Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC03982...
Company:Abnova Corporation

Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:... polyclonal antibody raised against a partial recombinant SF3B2. Immunogen: SF3B2 (NP_006833, 592 a.a. ~ 646 a.a) partial recombinant protein with gst tag. Accession Number: NM_006842 Protein Sequence: YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*...
Company:Abnova Corporation

PolarScreen Androgen Receptor Competitor Assay Kit, Red from Molecular Probes (Invitrogen)

Description:...ing and screening potential AR ligands using fluorescence polarization (FP). The kits contain rat AR ligand binding domain protein tagged with His and gst [AR-LBD (His-GST)], and a novel, selective fluorescent androgen ligand (Fluormone AL Green in the green assay kit or Fluormone AL Red in the red assay...
Company:Molecular Probes (Invitrogen)

Glutathione-S-Transferase (GST) Colorimetric Assay Kit from Sigma-Aldrich

Description:... carcinogenic, and toxic effects of the compounds. gst activity is present in plants, insects, yeast, bac...ey role in detoxification General description: The gst Assay is intended for total gst activity measurement in cell and bacterial lysates...
Company:Sigma-Aldrich
Other Tags
(Date:8/20/2014)... A new gene therapy developed by researchers at ... shown to protect mice from a life-threatening heart condition ... new therapeutic avenue," said Yi Lai, Ph.D., the leading ... the MU School of Medicine,s Department of Molecular Microbiology ... we hope this could lead to a treatment for ...
(Date:8/20/2014)... researchers have developed methods for electronically manipulating the flight ... moths use to control those muscles. The work opens ... "biobots," for use in emergency response. , "In the ... control the movement of moths for use in applications ... Bozkurt, an assistant professor of electrical and computer engineering ...
(Date:8/20/2014)... and POINT ROBERTS, Washington , ... Play a Key Role in Addressing Security Concerns in the ... a global news source covering leading sectors including biometrics, issues ... market. Jason Peaslee , Managing Partner at ... and Gino Pereira , CEO of NXT-ID, Inc. (OTCBB: ...
Breaking Biology News(10 mins):Gene therapy protects mice from lethal heart condition, MU researchers find 2Research paves way for development of cyborg moth 'biobots' 2Digital Wallets for a Digital World - the Players and the Concerns for Consumer Adoption 2Digital Wallets for a Digital World - the Players and the Concerns for Consumer Adoption 3Digital Wallets for a Digital World - the Players and the Concerns for Consumer Adoption 4Digital Wallets for a Digital World - the Players and the Concerns for Consumer Adoption 5Digital Wallets for a Digital World - the Players and the Concerns for Consumer Adoption 6Digital Wallets for a Digital World - the Players and the Concerns for Consumer Adoption 7
(Date:8/20/2014)... 2014 (HealthDay News) -- A new study found no ... treatment for high blood pressure increases patients, risk of ... high blood pressure can prevent strokes and other cardiovascular ... high blood pressure may lead to low blood pressure, ... They looked at about 3,100 patients, aged 40 ...
(Date:8/20/2014)... 20, 2014 Get the report here: ... mergermarket presents ‚ÄúDeal Drivers 2014 Half Year Report for ... M&A activity in both North and South America, with ... About Merrill DataSite     , Merrill DataSite is a ... the due diligence process by providing a highly efficient ...
(Date:8/20/2014)... Beach, Florida (PRWEB) August 20, 2014 ... Florida, with the help of their experienced surgeons trained ... of patients to regain their lost or inaccurate vision. ... for performing Lasik surgery is making it possible for ... aging disease which occurs normally in people in the ...
(Date:8/20/2014)... The award-winning plastic surgery group, The Aesthetic ... throughout Houston to a third office, located in Katy, ... building. ACPS plastic surgeon Dr. Rolando Morales said the ... has risen to become one of the largest, most ... since its establishment in 1996 by plastic surgeons Dr. ...
(Date:8/20/2014)... (PRWEB) August 20, 2014 According ... Market Research "Multiplexed Diagnostics Market (Technologies: Very High, ... Applications: Infectious Disease Diagnosis, Oncology, Autoimmune Diseases, Cardiac, ... Share, Growth, Trends and Forecast, 2013 - 2019", ... USD 2.8 billion in 2012 and is expected ...
Breaking Medicine News(10 mins):Health News:Tight Blood Pressure Control Doesn't Raise Risk of Falls, Study Says 2Health News:Register to Download Merrill DataSite's Report: Deal Drivers 2014 Half Year Report for the Americas 2Health News:Braverman Eye Center Now Offers Multifocal PresbyLasik in Florida by Trained Surgeons 2Health News:Aesthetic Center for Plastic Surgery Expands Its Reach in Texas 2Health News:Multiplexed Diagnostics Market: Global Industry Analysis, Size, Share, Growth, Trends and Forecast 2013 - 2019 2Health News:Multiplexed Diagnostics Market: Global Industry Analysis, Size, Share, Growth, Trends and Forecast 2013 - 2019 3Health News:Multiplexed Diagnostics Market: Global Industry Analysis, Size, Share, Growth, Trends and Forecast 2013 - 2019 4
Other Contents