Navigation Links


ABN at biology products

Mouse Anti-Human COASY Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant COASY. NCBI Entrez Gene ID = 80347...
Company:Abnova Corporation

Mouse Anti-Human LASS3 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant LASS3. NCBI Entrez Gene ID = 204219...
Company:Abnova Corporation

Mouse Anti-Human WDR5 Monoclonal Antibody, Unconjugated, Clone 2C2 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant WDR5. NCBI Entrez Gene ID = WDR5...
Company:Abnova Corporation

Mouse Anti-Human ZNF155 Monoclonal Antibody, Unconjugated, Clone 2F11 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant ZNF155. NCBI Entrez Gene ID = ZNF155...
Company:Abnova Corporation

Mouse Anti-Human FBXO11 Monoclonal Antibody, Unconjugated, Clone 4C12 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant FBXO11. NCBI Entrez Gene ID = FBXO11...
Company:Abnova Corporation

Mouse Anti-SF3B2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant SF3B2. YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY*...
Company:Abnova Corporation

Mouse Anti-Human NCLN Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant NCLN. NCBI Entrez Gene ID = 56926...
Company:Abnova Corporation

Mouse Anti-Human RAB11B Monoclonal Antibody, Unconjugated, Clone 2F1 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant RAB11B. NCBI Entrez Gene ID = RAB11B...
Company:Abnova Corporation

Mouse Anti-Human LDB3 Monoclonal Antibody, Unconjugated, Clone 3C8 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a full length recombinant LDB3. NCBI Entrez Gene ID = LDB3...
Company:Abnova Corporation

Mouse Anti-Human AGTRAP Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant AGTRAP. NCBI Entrez Gene ID = 57085...
Company:Abnova Corporation

Mouse Anti-Human IFNA13 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant IFNA13. NCBI Entrez Gene ID = 3447...
Company:Abnova Corporation

Mouse Anti-Human TSEN2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant TSEN2. NCBI Entrez Gene ID = 80746...
Company:Abnova Corporation

Mouse Anti-Human COG2 Monoclonal Antibody, Unconjugated, Clone 4C8 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant COG2. NCBI Entrez Gene ID = COG2...
Company:Abnova Corporation

Mouse Anti-Human JRKL Monoclonal Antibody, Unconjugated, Clone 4E10 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant JRKL. NCBI Entrez Gene ID = JRKL...
Company:Abnova Corporation

Mouse Anti-Human NR4A2 Monoclonal Antibody, Unconjugated, Clone 3E10 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant NR4A2. NCBI Entrez Gene ID = NR4A2...
Company:Abnova Corporation

Mouse Anti-Human NEK2 Monoclonal Antibody, Unconjugated, Clone 3B7 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant NEK2. NCBI Entrez Gene ID = NEK2...
Company:Abnova Corporation

Mouse Anti-Human MHC2TA Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant MHC2TA. NCBI Entrez Gene ID = 4261...
Company:Abnova Corporation

Mouse Anti-Human YARS Monoclonal Antibody, Unconjugated, Clone 2F3 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a full length recombinant YARS. NCBI Entrez Gene ID = YARS...
Company:Abnova Corporation

Mouse Anti-Human STAU2 Monoclonal Antibody, Unconjugated, Clone 6F9 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant STAU2. NCBI Entrez Gene ID = STAU2...
Company:Abnova Corporation

Mouse Anti-Human CENTB2 Monoclonal Antibody, Unconjugated, Clone 4G3 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant CENTB2. NCBI Entrez Gene ID = CENTB2...
Company:Abnova Corporation

Mouse Anti-IFNA2 Monoclonal Antibody, Unconjugated, Clone 1F11 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant IFNA2. Operation Date: </...
Company:Abnova Corporation

Mouse Anti-Human QPCT Monoclonal Antibody, Unconjugated, Clone 4E11 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = QPCT...
Company:Abnova Corporation

Mouse Anti-Human QPCT Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = 25797...
Company:Abnova Corporation

Mouse Anti-Human QARS Monoclonal Antibody, Unconjugated, Clone 5F5 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Company:Abnova Corporation

Mouse Anti-Human ALAS2 Monoclonal Antibody, Unconjugated, Clone 6C1 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant ALAS2. NCBI Entrez Gene ID = ALAS2...
Company:Abnova Corporation

Mouse Anti-Human SCGB3A2 Monoclonal Antibody, Unconjugated, Clone 1B2 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a full length recombinant SCGB3A2. NCBI Entrez Gene ID = SCGB3A2...
Company:Abnova Corporation

Mouse Anti-Human L3MBTL2 Monoclonal Antibody, Unconjugated, Clone 4F4 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Company:Abnova Corporation

Mouse Anti-Human DDEF2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Company:Abnova Corporation

Mouse Anti-Human PPIL2 Monoclonal Antibody, Unconjugated, Clone 2E11 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a full length recombinant PPIL2. NCBI Entrez Gene ID = PPIL2...
Company:Abnova Corporation

Mouse Anti-Human VRK2 Monoclonal Antibody, Unconjugated, Clone 3B10 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant VRK2. NCBI Entrez Gene ID = VRK2...
Company:Abnova Corporation

Mouse Anti-MAK Monoclonal Antibody, Unconjugated, Clone 4E9 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant MAK. 154...
Company:Abnova Corporation

DNA Visualizer Extraction Kit from Abnova Corporation

Description:DNA Visualizer Extraction Kit is manufactured for DNA purification from agarose gels without causing DNA damage byexposure to UV light. The Purification of DNA from an agarose gel is often used for DNA-cloning work. The conventional method of visualizing DNA with ethidium bromide and exposure of UV light damages DNA and significantly decreases cloning efficiency. Using DNA Visualizer Extraction K...
Company:Abnova Corporation

Mouse Anti-Human ST3GAL2 Monoclonal Antibody, Unconjugated, Clone 1E12 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant ST3GAL2. NCBI Entrez Gene ID = ST3GAL2...
Company:Abnova Corporation

Mouse Anti-Human CSNK2A2 Monoclonal Antibody, Unconjugated, Clone 4F2 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
Company:Abnova Corporation

DNA Visualizer DX from Abnova Corporation

Description:DNA Visualizer DX's sensitivity of DNA detection has been improved. With Gene Coloring Solution, a DNA band in an agarose gel can be detected > 20 ng. The excised DNA with this kit can be purified by organic solvent extraction or with other commercially available kits. (All tested commercially kits worked well.) DNA excised from agarose gel can be used for many downstream experiments, such as en...
Company:Abnova Corporation

Mouse Anti-K6HF Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant K6HF. TIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQGSRTVRQNLEPLFDSYTSELRRQLESITTERGRLEAELRNMQDVVEDFKVRYE*...
Company:Abnova Corporation

Mouse Anti-Human DHX8 Monoclonal Antibody, Unconjugated, Clone 1E10 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant DHX8. NCBI Entrez Gene ID = DHX8...
Company:Abnova Corporation

Mouse Anti-ZFHX4 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant ZFHX4. ETCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDNLKTDERKSEALLGFSVENAAATQVTSAKEIPCNECATSFPSLQ*...
Company:Abnova Corporation

Mouse Anti-XAGE2 Polyclonal Antibody, Unconjugated from Abnova Corporation

Description:Mouse polyclonal antibody raised against a partial recombinant XAGE2. RNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV*...
Company:Abnova Corporation

Mouse Anti-Human TPR Monoclonal Antibody, Unconjugated, Clone 1A8 from Abnova Corporation

Description:Mouse monoclonal antibody raised against a partial recombinant TPR. NCBI Entrez Gene ID = TPR...
Company:Abnova Corporation
Other TagsWitnessesbrokebroke
(Date:7/25/2008)...25, 2008) New research published in the July issu...ons shows elevated plasma DNA is a reliable marke...uggests that plasma DNA levels rise before clinica... patients. , Esophageal cancer, one of the lea...diagnosed at a late stage. An accurate marker for ...
(Date:7/24/2008)...shortages and growing demand for bio-fuels and hyd... among the greatest threats today to the preservat...developers look for new areas for agriculture, ene...resisting pressures to convert wetlands is vital t... of services essential to humanity, including safe...
(Date:7/24/2008)...eroids bulk up plants just as they do human athlet...l the genes to boost growth and development in pla... animal cells. A new study by plant biologists at ...r approach called proteomics to identify key links... these plant hormones activate genes could lead no...
(Date:7/24/2008)...ed with a telescope promise to make it easier for ...activities requiring sharper distance vision. Sche...e advantages of these innovative glasses over earl...e issue of Journal of Biomedical Optics , mailed ...is new design has several advantages," says the in...
Breaking Biology News(10 mins):Plasma DNA level is a reliable marker of recurrent esophageal cancer, study finds 2Rising energy, food prices major threats to wetlands as farmers eye new areas for crops 2Rising energy, food prices major threats to wetlands as farmers eye new areas for crops 3Plant steroids offer new paradigm for how hormones work 2Plant steroids offer new paradigm for how hormones work 3Telescope embedded in glasses lens promises to make driving easier for visually impaired 2Telescope embedded in glasses lens promises to make driving easier for visually impaired 3Extra Pounds During 3Ci 3Eand Between 3C i 3E Pregnancies Can Pose Problems 17251 1Extra Pounds During 3Ci 3Eand Between 3C i 3E Pregnancies Can Pose Problems 17251 2Extra Pounds During 3Ci 3Eand Between 3C i 3E Pregnancies Can Pose Problems 17251 3DuoCort Hosts Adrenal Insufficiency Symposium at the 10th European Congress of Endocrinology in Berlin 4711 1DuoCort Hosts Adrenal Insufficiency Symposium at the 10th European Congress of Endocrinology in Berlin 4711 2BioMed Realty Trust to Report 2008 First Quarter Results 17249 1BioMed Realty Trust to Report 2008 First Quarter Results 17249 2Playtex 28R 29 Offers Free Non BPA Baby Bottles to Parents Will Stop Using BPA in All Products This Year 17248 1Playtex 28R 29 Offers Free Non BPA Baby Bottles to Parents Will Stop Using BPA in All Products This Year 17248 2
(Date:7/25/2008)...wswire/ -- Sagent Pharmaceuticals, Inc.,a private...nounced that it,has launched amiodarone HCl inject... the treatment and prophylaxis of frequently recur...unstable ventricular,tachycardia -- a potentially ...iodarone HCl injection will be available immediate...
(Date:7/25/2008)...gus can cause immune system changes , , ...ence linking gastroesophageal reflux disease (GERD...y Medical Center researchers. , An association ...1970s, and since then studies have shown that betw...lso experience GERD symptoms. But the actual link ...
(Date:7/25/2008)...ou are an Olympian, Professional Athlete, Elite Am...u Need to Know about Hydration to Boost Sports Per...r , Marina del Rey, Calif...tes are heading to Beijing following years of inte...pes of capturing an Olympic medal and securing the...
(Date:7/24/2008)...ers at Wake Forest University Baptist Medical Cent...that the hepatitis C virus slows or stunts the imm...atients are treated with a combination of drugs kn...ction is more serious in HIV-infected people, lead...s for Disease Control. Intravenous drug use is a m...
Breaking Medicine News(10 mins):Health News:Sagent Pharmaceuticals Launches Amiodarone HCl Injection, USP 2Health News:Sagent Pharmaceuticals Launches Amiodarone HCl Injection, USP 3Health News:People With GERD More Likely to Develop Asthma 2Health News:Hydration Will Be Key For Beijing Bound Olympians, What Every Athlete Must Know 2Health News:Hydration Will Be Key For Beijing Bound Olympians, What Every Athlete Must Know 3Health News:Hydration Will Be Key For Beijing Bound Olympians, What Every Athlete Must Know 4Health News:Hydration Will Be Key For Beijing Bound Olympians, What Every Athlete Must Know 5Health News:Researchers disprove long-standing belief about HIV treatment 2Health News:Researchers disprove long-standing belief about HIV treatment 3
Other Contentsmyopiamyopiamyopiamyositismyositismyringotomymyotonicnarcolepsynarcolepsycongestioncongestioncongestionmyxedemaabnormalitiesabnormalitiesabnormalitiesabnormalitiesabnormalitiesabnormalitiesabnormalitiesabnormalities