Navigation Links


Surge in Biological News

Psychotropic drug prescriptions for teens surge 250 percent over 7 year period

Psychotropic drug prescriptions for teenagers skyrocketed 250 percent between 1994 and 2001, rising particularly sharply after 1999, when the federal government allowed direct-to-consumer advertising and looser promotion of off-label use of prescription drugs, according to a new Brandeis University...

Animal and plant communication at the ESA Annual Meeting

...t and surveying the density of generalist and specialist caterpillar species inside and outside the exclosures. In the exclosures, his team observed a surge in generalist density compared to natural areas. The number of specialists, however, only increased slightly. These results suggest that the bird pred...

Bioterrorism and disaster preparedness explored in special issue of Medical Decision Making

...esponse to it. The article "Predicting Hospital surge after a Large-Scale Anthrax Attack: A Model-Based ...countermeasures necessary to minimize the hospital surge resulting from anthrax-related illness and respons...repared for an attack--and how they respond to the surge in patients seeking carewill determine our success...

University of Miami receives stimulus funds for study of hurricane impacts on structures, ecosystems

... (SUSTAIN) research facility and a Marine Life Science Center. The SUSTAIN laboratory will be the only facility in the world with a wind-wave-storm surge simulator capable of generating hurricane force winds in a 3D test environment. The seawater pumped into the new building daily will allow scientists ...

Researchers see evidence of memory in the songbird brain

...xposed to a new song. These mRNAs are templates that allow the cell to translate individual genes into the proteins that do the work of the cells. Any surge or drop in the number of mRNAs in brain cells after a stimulus offers clues to how the brain is responding. Some genes were upregulated within 30 m...

Report updates guidelines on how much weight women should gain during pregnancy

...mal BMI. The new guidelines update recommendations the Institute of Medicine made in 1990 and reflect changing U.S. demographics, particularly the surge in the number of Americans who are overweight or obese. Healthy American women at a normal weight for their height (BMI of 18.5 to 24.9) should gain ...

Stanford scientists find heat-tolerant coral reefs that may resist climate change

...eaching." During particularly warm years, bleaching has accounted for the deaths of large numbers of corals. In the Caribbean in 2005, a heat surge caused more than 50 percent of corals to bleach, and many still have not recovered, according to the Global Coral Reef Monitoring Network, an internat...

Wetlands likely source of methane from ancient warming event

...he planet warms. By measuring the amount of carbon-14 isotopes in methane from air bubbles trapped in glacial ice, the researchers determined that the surge that took place nearly 12,000 years ago was more chemically consistent with an expansion of wetlands. Wetland regions, which produce large amounts of ...

ABBTECH Staffing Services Certified by GSA as an HSPD-12 Managed Service Provider

...national rollouts under subcontract to numerous program prime contractors. "Our unique approach allows the prime contractor the ability to have a surge capacity of skilled and vetted staff that is often needed for rapid deployment without the added burden of recruitment in diverse geographical locatio...

ABBTECH Staffing Services Certified by GSA as an HSPD-12 Managed Service Provider

...national rollouts under subcontract to numerous program prime contractors. "Our unique approach allows the prime contractor the ability to have a surge capacity of skilled and vetted staff that is often needed for rapid deployment without the added burden of recruitment in diverse geographical locatio...

New research shows high-quality protein in eggs contributes to power, strength and energy

...th, power and energy in the following ways: Sustained energy: The protein in eggs provides steady and sustained energy because it does not cause a surge in blood sugar or insulin levels, which can lead to a rebound effect or energy "crash" as levels drop. Eggs are a nutrient-rich source of high-quality...

More accurate FEMA flood maps could help avoid significant damages and losses

...also be improved by updating current models and using two-dimensional storm surge and wave models. Flood maps are used by FEMA to set flood insurance rate...l. Further enhancements could come by coupling this with a two-dimensional surge model and including models that account for erosion processes, effects on s...

Trees won't stop tsunamis, scientists warn

...vidence that coastal tree belts can provide meaningful protection against a tsunami or, for that matter storm surges produced by cyclones, such as the surge that followed Cyclone Nargis in Myanmar early this year which killed over 150,000 people. As a result it would be extremely dangerous to rely on tr...

USGS Science Picks

...lies in Glacier National Park? Watch a Glacier surge into a River in Near Real Time Free, Global A...ts to ponder or investigate) Watch a Glacier surge into a River in Near Real Time Want to see what... to protect communities from potential floods. The surge began during the fall of 2007, and since then, the...

Dune and dirty: Hurricane teaches lessons through ecosystem research

...ment gets blown out from the beach, dunes and upland is deposited in the marsh," Feagin said. "But our research on the backside of Galveston where the surge was around 12 feet shows it lost elevation. The marshes need to maintain a fairly shallow water depth to support their unique ecosystem. And sea level...

bioMETRX, Inc. Highlights 3rd Quarter 2008 Financial Results

...e last three months. Today, economic concerns trouble consumers and retailers report dramatic downturns in consumer spending; however, we are seeing a surge in sales of our products that protect consumer valuables and are priced right," noted Kevin Henderson, Senior V.P. at bioMETRX. "We are extre...

Personalized medicine: Innovative online journal leads the way

... The recent surge of DNA sequence information resulting from deciphering the human genetic code has acted as a catalyst for innovative technological developments that h...

Rhode Island Hospital simulation center examines benefits and applications of medical simulation

...d on the panel that generated "Defining Systems Expertise: Effective Simulation at the Organizational Level--Implications for Patient Safety, Disaster surge Capacity, and Facilitating the Systems Interface." David G. Lindquist, MD, Mary L. Salisbury, RN, MSN, and Andrew Sucov, MD, are among the additional ...

The Marine Mammal Center begins new leptospirosis study in California

...sea lions this year and is leading a study to determine when and why the sea lions contract this disease. Every four to five years, the Center sees a surge in the number of sea lions admitted as a result of this bacterial infection that affects the kidneys and can be lethal for patients. The current rese...

Wetlands restoration not a panacea for Louisiana coast

...ls to rise as the storm makes landfall. This storm surge can range from several to 30-plus feet and, along ...tlands on storm surge, you need to have good storm surge data to understand what happened in the past. But ...ng on at the coast." The problem is that storm surge is hard to measure. "You can't just go out there a...

New studies find global warming will have significant economic impacts on Florida coasts

...on to $12.3 billion in 2080). The study also calculated the effect of storm surge and sea level rise on future damage costs, finding that if a storm like Hur...cts," Murley said. "Storm events associated with certain levels of storm surge could increase in frequency in the future, due to sea level rise," Harringt...

August LabBits: A media tip sheet from the MBL in Woods Hole

... MBL, WOODS HOLE, MASummer on Cape Cod is synonymous with a surge of tourists, but also a surge of scientists at the MBL (Marine Biological Laboratory). For more than a ce...

Pregnant mice block out unwelcome admirers to protect their pups

...BL) in Monterotondo, Italy, have now revealed the nature of this ability. A surge of the chemical signal dopamine in the main olfactory bulb - one of the key...r the pregnancy," explains Minichiello. Following coitus, a progressive surge of the chemical signal dopamine takes place in the main olfactory bulb, the...

Extended cyclone relief efforts aided from space

...d mapping products were created with Earth observation (EO) satellite acquisitions taken in the wake of the event to derive an estimation of the flood surge impact and other damage information to help plan emergency response operations. Damage maps were able to be created quickly because the RESPOND proj...

Insects evolved radically different strategy to smell

...nel, the protein changes its shape much like a gate or door changes its conformation as it is opened and closed. Opened, it allows millions of ions to surge into the cell. Closed, it prohibits the activity of the ions from sending a signal to the brain that an odor is present. At the University of Toky...

Genetic tags reveal secrets of memories' staying power in mice

... a procedure called extinction learning. This indicated that the same neurons activated when a fear is learned are also activated when it is lost. The surge in mushroom spine capture of the receptors appeared within hours of learning and was gone after a few days, but appeared to be critical for cementing ...

Study locates cholesterol genes; finds surprises about good, bad cholesterol

...or less than a quarter of the genetic contributions to lipid levels. The completion of the map of human genetic variation, or HapMap, has fueled a surge in this type of genome-wide association study, with most of the growth coming in the past 10 months. Researchers around the globe have now associated ...

Study suggests genetic connection between short stature and arthritis

...teoarthritis of the hip and knees in Asian and European populations. The completion of the map of human genetic variation, or HapMap, has fueled a surge in this type of genome-wide association study, with most of the growth coming in the past 10 months. Researchers around the globe have now associated ...

Researchers uncover new piece to the puzzle of human height

...enome, to identify the exact genetic variant that affects the trait. The completion of the map of human genetic variation, or HapMap, has fueled a surge in genome-wide association studies, with most of the increase coming in the past 10 months. Researchers around the globe have now associated more than...

Stowers Institute's Hawley Lab identifies factors responsible for restart of meiotic cycle

...serves exactly this function by inhibiting Polo kinase. However, at the proper point in oocyte development, Matrimony is destroyed releasing a sudden surge of active Polo kinase. It is this precisely timed release of active Polo kinase that restarts meiosis. Matrimony is the first known protein inhibi...

Best treatment identified to reduce deadly Staph infections

...n Society of Health-System Pharmacists, by David Bearden, a clinical associate professor in the College of Pharmacy at Oregon State University. The surge in MRSA infections which have been called a superbug and medical experts say killed more people than AIDS in 2005 has alarmed health professionals. ...

Insulin's brain impact links drugs and diabetes

...vel of dopamine signaling. Some of these compounds, including amphetamine, also cause a massive outpouring of dopamine through DATs. The resulting surge of synaptic dopamine alters attention, increases motor activity and plays an important role in the addictive properties of psychostimulants. But t...

The endocannabinoids: Functional roles and therapeutic opportunities

... is highest among 15- to 24-year-olds, with lifetime prevalence ranging for most countries from 2040% (EMCDDA 2006). Recently there has been a new surge in the level of concern about potential social and health outcomes of cannabis use, although the available evidence still does not provide a clear-cut...

Smithsonian scientists working to save microscopic threatened species

...coaxing the 12,000 coral larvae to settle in a specially designed tank. The 90-gallon, salt-water tank features high-wattage lights and a custom-built surge device that mimics the movement of the surf in the corals native Caribbean habitat. From the original 12,000, 158 larvae settled onto specially de...

Scientist-evangelical Alaska expedition

...n Sarichef Island in the Chukchi Sea, for over 400 years. Because of melting sea ice and permafrost, however, the village is at high risk from storm surge erosion, and already 14 houses have fallen into the sea in recent years, raising concern that the village will soon need to be relocated to the main...

Salty oceans provide early warning for climate change

...tlantic, despite the two areas being thousands of kilometres apart. “A salt surge is enough to kick start circulation,” says Zahn. Meanwhile, a decrease in s...at energy is transferred through the ocean along a deep pressure wave. “The surge of salt generates a pressure gradient in the ocean that sends energy to the...

Study offers clues to 'Broken Heart Syndrome'

...appears to be minimal stress, while other women experience severely stressful events but don't develop Takotsubo cardiomyopathy," Dr. Regnante said. A surge of stress hormones likely plays a role, he said, but it is also possible that a blood clot temporarily blocks a major artery of the heart, then dissol...

Tundra disappearing at rapid rate

... new research shows that this shift will not always occur gradually but can surge ahead. "The conventional thinking on treeline dynamics has been that ...logical Sciences. "But what our data indicates is that there was an upslope surge of trees in response to warmer temperatures. It’s like it waited until cond...

Meeting the ethanol challenge: Scientists use supercomputer to target cellulose bottleneck

...ualizations of the results on the cover. A convergence of factors from looming global warming to unstable international oil supplies is driving a surge in renewable biofuels such as ethanol, with worldwide ethanol production more than doubling between 2000 and 2005. To date, corn has been the favorite...

Stormy days ahead for coral reefs

...entific journal Nature, Dr Joshua Madin and Dr Sean Connolly use mathematical models to calculate the forces that coral is subjected to by wave, storm surge or tsunami, and the probability of the colonies being ripped from the sea-bed. How coral assemblages respond to the power of the sea is essentia...
Other TagsHandleHandleMultivitamins
(Date:11/24/2009)... protein that may help gut bacteria bind to the ga... probiotic producers to identify strains that are ...tics need to interact with cells lining the gut to...urfaces in the gut they are more likely to stick a...r Nathalie Juge from the Institute of Food Researc...
(Date:11/24/2009)...mber 24, 2009) -- The Wildlife Conservation Societ...e last remaining population of Siberian tigers has...ide of poaching and habitat loss. , ...ials of what needs to be done to protect remaining... The report was released by the Siberian Ti...
(Date:11/24/2009)... Spanish . , The presence of increased body ...ubstances in the blood, hinders the loss and maint...ect of the University of Navarra conducted by Estb... Pharmacy. , The project, entitled "A nutrigenet...ol of body weight and inflammation," examines how ...
Breaking Biology News(10 mins):A sticky solution for identifying effective probiotics 2Report shows dramatic decline in Siberian tigers 2It can be predicted the reaction obese patients will have to a diet 2Shrinking Bylot Island glaciers tell story of climate change 9745 1Shrinking Bylot Island glaciers tell story of climate change 9745 2Shrinking Bylot Island glaciers tell story of climate change 9745 3Shrinking Bylot Island glaciers tell story of climate change 9745 4Kaiser Workers Statewide Campaign Starts Tuesday 55751 1Kaiser Workers Statewide Campaign Starts Tuesday 55751 2This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 1This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 2This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 3This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 4
(Date:11/24/2009)..., NEWYORK,Nov.24/PRNewswire-USNewswire/--Ther...oblems.Itisharmreduction,offeringpragmaticandreali...roblemshavefailed.Spearheadingthismovementisagroup...rationSupport.HAMSisafree-of-charge,lay-ledsupport..., TheNationalInstituteonAlcoholAbuseandAlcoholism...
(Date:11/24/2009)..., NEWYORK,Nov.24/PRNewswire/--TheGuardianLife...tmutuallifeinsurersandaleadingproviderofemployeebe...thatthecompanywillcontinuetofollowitscurrentinsura...eguidelinesareconsistentwiththeAmericanCancerSocie...sformammographyscreenings. ,, Recently,TheU.S.P...
(Date:11/24/2009)..., ChangesMustBeMadetoUSPSTFRepresentationand...ewswire-USNewswire/-- SeveralsectionsofSenatehealt...hatinsuranceentitiessuchasprivateinsurers,Medicare...vingaspecificgradefromtheU.S.PreventativeServicesT...icesforwomen40-49,wouldonlyrequirecoverageofbienni...
(Date:11/24/2009)... BEER-SHEVA, ISRAEL November 24, 2009 Researchers...ing a new device that detects cancerous skin tumor...naked eye. , During initial testing, the OSPI in...vealed new textures of lesions that have never bee... were diagnosed with various skin lesions and were...
(Date:11/24/2009)... INDIANAPOLIS Involving family members of pediatr...s benefits both the family and the medical team, a...icine study. , Riley Hospital for Children, whe...mall number of hospitals nationwide routinely offe...y patients the opportunity to join their child,s m...
Breaking Medicine News(10 mins):Health News:Harm Reduction for Alcohol: An Idea Whose Time Has Arrived 2Health News:USPSTF Mammography Recommendations Should Be Specifically Excluded From Health Care Reform Legislation 2Health News:USPSTF Mammography Recommendations Should Be Specifically Excluded From Health Care Reform Legislation 3Health News:New device enables early detection of cancerous skin tumors -- Ben Gurion U. 2Health News:Involving family in medical rounds benefits both family and medical team 2Health News:Involving family in medical rounds benefits both family and medical team 3Health News:Involving family in medical rounds benefits both family and medical team 4
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria