Navigation Links


Tag: "treatment" at biology news

Chemists create 'Superbowl' molecule; May lead to better health

...eas of the body, potentially resulting in improved treatment outcomes and perhaps saving lives, the researchers say. The molecule also shows promise for a wide range of other applications, including the removal of environmental toxins and aiding in chemical purification procedures, the investigators say. Thei...

Spleen may be source of versatile stem cells

...earlier work."In 2001 Faustman's team found that a treatment designed to address theautoimmune reaction underlying type 1 diabetes actually cured thedisease in diabetic mice. Late in 2003 they reported the mechanismbehind the earlier discovery: cells from the spleens of donor mice -intended to train the diabet...

Source of molecular triggers in cutaneous T cell lymphoma identified

...implications for the understanding, diagnosis, and treatment of CTCL, as well as potentially contributing to the investigation of other types of lymphomas," said Edelson. "It may now be possible to identify specific antigens and target the malignant cells with selective poisons delivered through the vehicle of...

Protein discovery could unlock the secret to better TB treatment

...could unlock the secret to quicker, more effective treatment of TB by waking TB bacteria in the body. Once the ... will lead the way to designing drugs which enable treatment of dormant and multidrug resistant TB. In England and Wales around 400 people die each year from th...

New binding target for oncogenic viral protein

... This is an important step to designing new cancer treatment strategies that target these pathways," concluded Dr. Clurman. ...

Controversial drug shown to act on brain protein to cut alcohol use

...mpioned for years by acadre of clinicians and drug treatment advocates impressed with itsability to reverse withdrawal symptoms and craving for alcohol andvarious drugs of abuse. It has been used outside of the U.S. to treataddiction by American and other clinicians. But its side effects,including hallucinatio...

Elusive HIV shape change revealed; Key clue to how virus infects cells

...ture, offer clues that will help guide vaccine and treatment approaches. Researchers led by Howard Hughes Medical Institute Investigator Stephen Harrison, PhD, and Bing Chen, PhD, focused on the gp120 protein, part of HIV's outer membrane, or envelope. gp120's job is to recognize and bind to the so-called CD4...

Mouse brain cells rapidly recover after Alzheimer's plaques are cleared

...heal. Brendzaplans to look into whether additional treatment can prompt theirrecovery.Holtzman and Brendza plan to continue using the mouse model to studydisease treatments and the cellular abnormalities caused by theirAlzheimer's-like condition."For example, we'd like to know what's going wrong in the nerve c...

Key molecule in plant photo-protection identified

...heal. Brendzaplans to look into whether additional treatment can prompt theirrecovery.Holtzman and Brendza plan to continue using the mouse model to studydisease treatments and the cellular abnormalities caused by theirAlzheimer's-like condition."For example, we'd like to know what's going wrong in the nerve c...

Anti-bacterial additive widespread in U.S. waterways

... well as from local water filtration andwastewater treatment plants. From the samples, Dr. Halden and hissummer research intern, Daniel H. Paull, now a graduate student in theChemistry department at Johns Hopkins University, observed theoccurrence of triclocarban in the environment correlated strongly withthat...

Tiny particles could solve billion-dollar problem

...osts for new wells, construction costs for surface treatment facilities and energy costs of lifting water to the surface. Nanotechnology is critical to the scheme because only a nanoscale catalyst will be efficient enough to provide the throughput needed to make the whole approach effective. Tests in Wong's l...

Recent breakthroughs in common adult leukemia highlighted in New England Journal of Medicine

...ical courses in patients. Some patients require no treatment and have a lifespan of more than 20 years after diagnosis. Since the disease most often strikes older adults, the patients whose disease follows this course usually die with the disease, not because of it. CLL may also follow a more aggressive course...

Novel antiviral technology inhibits RSV infection in mice

A novel antiviral treatment combiningnanoparticle and gene silencing technolog... immune systems. Novaccine or widespread antiviral treatment is available for theinfection. Researchersat USF's Joy McCann Culverhouse Airway Disease Research C...

Transplantation Of Monkey Embryonic Stem Cells Reverses Parkinson Disease In Primates

... replenishment of missing neurons in thebrain as a treatment for Parkinson disease reached the stage of humantrials over 15 years ago, however the field is still in its infancy.Researchers from Kyoto University have now shown thatdopamine-producing neurons (DA neurons) generated from monkey embryonicstem cells...

Inexpensive, mass-produced genes core of synthetic biology advances at UH

...edures. Gene therapyis a promising approach to the treatment of genetic disorders,debilitating neurological dis...es that could beespecially useful in detection and treatment of infectious organismsthat could be used by terrorists....

HIV Patients May Be at Risk of Heart Problems When Taking Protease Inhibitor Drugs

...e these drugs are too important for the successful treatment of HIV viral infection and control of AIDS. But hopefully our findings will save lives by alerting the physician to yet another side effect associated with this class of drug." Dr. Ackerman is director of Mayo Clinic's Long QT Syndrome Clinic and Su...

Combination therapy boosts effectiveness of telomere-directed cancer cell death

...ow to boost the effectivenessof a promising cancer treatment that targets telomeres in an attempt tointerfere w...his strategy would shorten the time period of drug treatment that isrequired for the onset of telomere crisis and reduce the potential riskof acquired drug resis...

GATA: a graphic alignment tool for comparative sequence analysis

...ow to boost the effectivenessof a promising cancer treatment that targets telomeres in an attempt tointerfere w...his strategy would shorten the time period of drug treatment that isrequired for the onset of telomere crisis and reduce the potential riskof acquired drug resis...

“Nano-scissors?laser shows precise surgical capability

... nerve regeneration andis an important step toward treatment of human neurological disease,according to research published in the Dec. 16 issue of Nature. Dr.Adela Ben-Yakar, an assistant professor of mechanical engineering atThe University of Texas at Austin, led the development of thetechnique. It acts like...

U of M researcher examines newly emerging deadly disease

...fulminans to better understand the causes and best treatment options." On the basis of experience, the University of Minnesota experts have identified three recommended treatments for purpura fulminans. Patients who present symptoms of purpura should receive antibiotic therapy not only against Neisseria menin...

1 2 3 4 5 6 7 8 9 10

Other Tagsdifferential 2vitamins 2ultimate 2ultimate 3ultimate 4ultimate 5
(Date:11/20/2009)...searchers report that a class of heart medications...ul, effect on the heart, depending on their molecu...journal Circulation Research , found that beta-bl...ors on the heart muscle offer the most benefit to ... beta-receptors can actually undermine the structu...
(Date:11/19/2009)...revealing the genetic instructions inside corn, on...as one of the most complex sequences of DNA ever a...micist David Schwartz, who was one of more than 10... , "The maize genome is a true maze full of con...uld-be sequencers for years," says Schwartz. , P...
(Date:11/19/2009)...rsity in maize, also known as corn, researchers ac...that should pave the way to significant improvemen..., animal feed and fiber around the world. , The ...lotype map, charts genetic diversity and recombina.... The research team, led by U.S. Department of Agr...
Breaking Biology News(10 mins):Carvedilol shown to have unique characteristics among beta blockers 2Sweet corn story begins in UW-Madison lab 2Sweet corn story begins in UW-Madison lab 3Clearly Contacts Introduces New Spring Eyewear Lineup 47736 1Clearly Contacts Introduces New Spring Eyewear Lineup 47736 2Clearly Contacts Introduces New Spring Eyewear Lineup 47736 3Wake Up 26 Smell the Coffee 47731 1Wake Up 26 Smell the Coffee 47731 2Wake Up 26 Smell the Coffee 47731 3Parents In Kansas Can Now Test Their Children For Lead Exposure Using Saliva 47727 1Parents In Kansas Can Now Test Their Children For Lead Exposure Using Saliva 47727 2Parents In Kansas Can Now Test Their Children For Lead Exposure Using Saliva 47727 3Parents In Kansas Can Now Test Their Children For Lead Exposure Using Saliva 47727 4
(Date:11/20/2009)... , ST. LOUIS, Nov. 20 /PRNewswire-FirstCall/ -...nced that it will present at the Bank of America M...cember 2-3, 2009, at the Crowne Plaza Hotel Times ...t Wednesday, December 2nd at 8:30 a.m. Eastern Tim...ss a live, audio webcast of Centene,s presentation...
(Date:11/20/2009)..., WINSTON-SALEM, N.C., Nov. 20 /PRNewswire-USNew... on a mission to redefine what it means to be "hap...l counselor with a specialty in family counseling ...Forest University, Gladding says research shows th... to sadness and even depression during the holiday...
(Date:11/20/2009)... , NEW YORK, Nov. 20 /PRNewswire-FirstCall/ ...ced that it will broadcast Doctor Radio Reports..., an in-depth special hosted by veteran journalist...m/cgi-bin/prnh/20080819/NYTU044LOGO ) ,, Docto...About Mammograms will air November 21 live at 1...
(Date:11/20/2009)...durations of exposure to formaldehyde used for emb...h an increased risk of death from myeloid leukemia...er 20 in the Journal of the National Cancer Insti...ality from lymphohematopoietic malignancies and br...l industry workers, all of whom may have worked wi...
(Date:11/20/2009)...tle, Washington) November 20, 2009Emergency medica...ess an estimated 350,000 cardiac arrests each year...cardiac arrest survive. Better quality cardiopulm...EMS providers may be associated with better patien...(ROC) is the largest clinical research network to ...
Breaking Medicine News(10 mins):Health News:Why Holidays Don't Have To Be 'Happy' 2Health News:SIRIUS XM to Broadcast 'Doctor Radio Reports: What Every Woman Needs To Know About Mammograms' 2Health News:SIRIUS XM to Broadcast 'Doctor Radio Reports: What Every Woman Needs To Know About Mammograms' 3Health News:SIRIUS XM to Broadcast 'Doctor Radio Reports: What Every Woman Needs To Know About Mammograms' 4Health News:SIRIUS XM to Broadcast 'Doctor Radio Reports: What Every Woman Needs To Know About Mammograms' 5Health News:Funeral industry workers exposed to formaldehyde face higher risk of leukemia 2Health News:Effect of real-time CPR feedback reported at resuscitation science symposium 2Health News:Effect of real-time CPR feedback reported at resuscitation science symposium 3
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesisclade