Navigation Links


Tag: "stress" at biology news

Over a century after disappearing, wild elk return to Ontario

...cularly due to wolf predation, illegal hunting and stress from the transfer process. However, the death rate is decreasing each year, suggesting that the animals are adapting to their new home. Although pleased with the program’s success to date, Rosatte asserts that the work is far from over. "Our chall...

Scientists unravel clue in cortisol production

When a person's under stress or injured, the adrenal gland releases cortisol to...lar Endocrinology. Turning cholesterol into the stress hormone cortisol involves many reactions and begins when the hypothalamus sends a signal to the adre...

Salamanders suffer delayed effects of common herbicide

...They can be seen as bioindicators of environmental stress and harbingers of risk to other animals as well as humans," explained Rohr, also affiliated with Penn State's Center for Infectious Disease Dynamics. ...

A steady, high-fat diet is bad, but the news gets worse

... more prone to suffer the physical consequences of stress than those who eat a low-fat meal. Published this... the Journal of Nutrition, the study looked at the stress responses of two groups of students: one group consumed a fast-food breakfast from McDonald’s, the o...

Mosquito genes explain response to climate change

...hers. Plants and animals are not confronting this stress directly, but rather they are flowering, reproducing and going dormant at different times of the year than they used to. Many species will be unable to change quickly enough and will become extinct." "Climate change will change the seasonal ecolo...

Protein found to shield pancreatic cancer cells from self-destruction

...arily increased in response to certain hormones or stress factors. "However, constitutive expression of this protein in a cancer cell helps confer protection from stress-induced cell death," Mehta says. "We are developing TG2 as a pharmaceutical target and are now working with a mouse model to that end." ...

Gene chips forecast ecological impacts of climate change

... finding ways to assess the effects of temperature stress and low pH, due to ocean acidification, on adults ...cidification are more problematic than temperature stress alone. Data presented will show how gene chips and other molecular approaches can assist in understa...

Nanotechnology shows promise as next wrinkle fighter

... no wrinkles. The nanoparticles in the film can be stress busters without affecting the neighboring layers. ...ree films will automatically absorb or deflect the stress and stay flat, just as they are after formation," he said. Nanoparticle films wouldn't be a fac...

Antivirals effectively curb influenza virus

...lthough these results are of interest, the authors stress that the numbers were small and combined estimates from two studies for each drug were used in both instances. Furthermore, oseltamivir treatment of ill persons did not appear to reduce the frequency of influenza infection in their contacts. In ex...

Trojan horse strategy defeats drug-resistant bacteria

...cteria in test tubes, they sought to intensify the stress imposed on microbes by one of the body's own defense mechanisms. "The competition for iron is critical in the struggle between bacteria and host," explained the study's senior author, Pradeep Singh, associate professor of medicine and microbiolog...

Exploring the molecular origin of blood clot flexibility

...gen molecule would be the part to unfold under the stress induced by the atomic force microscope," notes Brown. Once the origins of the mechanical properties of clots are well understood, it may be possible to modulate those properties, note the study authors. "If we can change a certain parameter perhap...

Destructive enzyme shows a benevolent side

...tein. This new study found, however, that under stress conditions, the same enzyme ?while attached to the...lps form temporary shelters within the cell called stress granules. There, the mRNA can be protected so that production of the protein can quickly resume when...

Grape expectations for healthier wine

...unds are up-regulated in response to environmental stress in plant cells, it could be that the ozone is perceived as a biochemical insult. Andrew Waterhouse, Chair of the Department of Viticulture at University of California, Davis, said that because wine growers don't store grapes for prolonged periods,...

Molecular differences between early and advanced melanomas could provide new drug targets

...t of the prolonged exposure to increased oxidative stress caused by Akt overexpression, but that the mitochondrial mutations were not essential for the aggressive growth of melanomas induced by Akt. "Our research shows that Akt overexpression on its own is sufficient to transform radial growth melanoma ...

Anxiety disorders surprisingly common yet often untreated

...d anxiety disorder, panic disorder, post traumatic stress disorder or social anxiety disorder. The new study, which looked at 965 patients in 15 primary care clinics, found anxiety to be as prevalent as depression, and much more common than previously thought, in patients who were visiting a physician for a...

New recommendations against a major opportunistic infection -- cryptococcosis

...evere pneumonia", concludes Dromer. The authors stress that the three-month mortality rate from cryptococcosis remains 15-20% in Western countries, and that this is much higher in Africa and Asia: this greatly justifies improving the therapeutic management of this disease in the future. ...

How fish species suffer as a result of warmer waters

...irst to deteriorate, followed by other biochemical stress responses. Finally, oxygen supply fails entirely, leaving the organism to perish. These results represent a significant step forward towards understanding the mechanisms involved in climate-induced alterations in marine ecosystems. The paper 'Clim...

Bisexual fruit flies show new role for neurochemical

...eral sclerosis, muscular dystrophy, post-traumatic stress syndrome and schizophrenia is influenced by the number of receptors on nerve cells. The more receptors each cell has at its communication points, or synapses, the better that messages are carried through the brain. A UIC research team led by David ...

Scientists find hormone activity explains adolescent mood swings

...s" of puberty are known to produce mood swings and stress for most teenagers, making it difficult to cope wi...ain that "calm" brain activity. In the adult, this stress hormone helps the individual adapt to stress, with a calming effect produced half an hour after the ...

Stress may help cancer cells resist treatment, research shows

...chool of Medicine are the first to report that the stress hormone epinephrine causes changes in prostate and...t to cell death. "These data imply that emotional stress may contribute to the development of cancer and may also reduce the effectiveness of cancer treatmen...

1 2 3 4 5 6 7 8 9 10

Other Tagsstabilize 2stabilize 3forming 2forming 3forming 4forming 5forming 6forming 7skills 2skills 3skills 4Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircular