Navigation Links


Tag: "offer" at biology news

Discovery in orange cauliflower may lead to more nutritious crops

...ases a plant's ability to store beta-carotene, may offer an alternate and complementary technique for making staple crops more nutritious. Li, in collaboration with Joyce Van Eck from the Boyce Thompson Institute for Plant Research at Cornell, is currently working on transgenic potatoes, altering genes t...

Research shows cord blood comparable to matched bone marrow

...s report that umbilical cord blood transplants may offer blood cancer patients better outcomes than bone marrow transplants, according to an analysis of outcome data performed at the Center for International Blood and Marrow Transplant Research (CIBMTR), Medical College of Wisconsin, Milwaukee. This is th...

New collaborative research reveals chimpanzees can sustain multiple-tradition cultures

...es potentially can jump from group to group if you offer chimpanzees the opportunity to watch other groups. It’s a bit like Westerners learning to eat with chopsticks."...

Breakthrough developments in rheumatoid arthritis reported

... identify the disease before it starts and perhaps offer treatments to stave off the symptoms. It turns out that those with these antibodies who also have a particular variety of HLA, a complex of genes that regulate immune function, have a 30 times higher risk of developing rheumatoid arthritis than those...

Could fungal collection hold the key to new life-saving drugs?

...ion, along with the expertise of its scientists to offer a range of services to businesses, including fungal identification, sales, preservations, patenting, training and consultancy. The partnership with SIDR will see CABI’s collection taken one step further, with the fungi being exploited for natural pr...

Nurtured chimps rake it in

...g-term effects on their cognitive development, and offer direct comparisons with early experience, issues of attachment, and preschool education for human infants and children,” The authors conclude that the differences in performance between the three groups are directly attributable to the significant...

Surprising origin of cell's internal highways

...her study of this new subset of microtubules might offer insight into how the invasion of cancer cells into surrounding tissues could be halted. ...

The mouflons of the Kerguelen archipelago

...station. In 1957, the local authorities decided to offer residents the opportunity to hunt mouflons (a type of wild sheep). A pair of Corsican mouflons was imported from the Vincennes Zoo in Paris. Initially, the mouflon population grew exponentially, and then, from the early 1980s, it fluctuated between 3...

Gene therapy study shows safety and statistically significant improvement in Parkinson's disease

...he brain are impressive. Moreover, the PET results offer an important window into the function of the living brain in these patients, which supports a normalization of brain activity specific to the treated hemisphere.” The study used an adeno-associated virus (AAV) vector to deliver an inhibitory gene ...

New designer lipid-like peptide with lipid nanostructures for drug delivery systems

...e paints, with confined inner nanostructures, will offer unique characteristics like high drug load capacities and low viscosity. Here these designer lipid-like peptides may play a key role in improving effective drug delivery systems....

Gene expression patterns predict rapid decline in idiopathic pulmonary fibrosis patients

...y of Pittsburgh School of Medicine, these findings offer strong evidence that rapid progressors represent a distinct clinical phenotype compared with the usual slower progressing patients. "We are only now starting to really understand IPF and to characterize it," Dr. Kaminski said. "Therefore, it is cr...

Detecting cold, feeling pain: Study reveals why menthol feels fresh

...tors discovered in recent years by the Julius lab, offer potential targets for developing analgesic drugs that act in the peripheral, nervous system, rather than centrally, where opiate receptors act, he says. The finding is a milestone in an investigation the team began several years ago. In 2002, the ...

Human stem cell treatment restores motor function in paralyzed rats

... their efficacy. “These research findings could offer great hope to people with spinal ischemic injury who suffer from resulting spasticity and rigidity,” said Marsala. ...

Gene malfunctions cause schizophrenia, depression symptoms in mice

... those disorders. They said their findings in mice offer a possible animal model for developing treatments for schizophrenia and depression. Also, they said their findings support the theory that the two disorders share common genetic mechanisms. Steven Clapcote, David Porteous, John Roder, and colleagues...

Peramivir protects mice from lethal H5N1 infection

The antiviral drug peramivir might offer humans significant protection during a pandemic of the avian influenza virus H5N1, according to results of mouse studies conducted by investigators at St. Jude Children's Research Hospital. Peramivir, an antiviral drug, blocks the ability of influ...

US control strategies may make flu epidemics worse, UCLA study shows

...pidemics and pandemics unless vaccination programs offer incentives to individuals. According to the researchers, the severity of such a health crisis could be reduced if programs were to provide several years of free vaccinations to individuals who pay for only one year. Interestingly, however, some in...

Maggots rid patients of MRSA

...andomized controlled trial, larval treatment would offer the first non-invasive and risk-free treatment of this increasing problem and a safe and cost-effective treatment in contrast to the expensive and potentially toxic antibiotic remedies." ...

Corals -- More complex than you?

... Despite all they mean to Australia and have to offer science and medicine, our corals remain genetically largely unexplored, Prof. Miller says. "There is no project to sequence the coral genome, in spite of the tremendous benefits to medicine and other branches of science such a project would offer. ...

8 plants from South Africa may hold potential for treating high blood pressure

...RB). These drugs not only lower blood pressure but offer additional protection to the brain and heart. ACEI, in particular, provide beneficial properties to patients with type 1 diabetes. In an effort to identify indigenous plants consumed by the local population in Kwa-Zulu Natal that hold potential an...

New technique will produce a better chromosome map

...s way provide useable images and even those rarely offer crisp structural details, Novikov said. The new approach includes two components: the use of mechanical devices to spread and flatten the cells, and the application of computer-based image processing to analyze hundreds of examples of the same chr...

1 2 3 4 5 6 7 8 9 10

Other Tagsencounters 2seven 2seven 3seven 4seven 5seven 6seven 7seven 8seven 9seven 10fails 2fails 3predation 2along 2along 3along 4along 5along 6along 7along 8along 9along 10
(Date:11/24/2009)... protein that may help gut bacteria bind to the ga... probiotic producers to identify strains that are ...tics need to interact with cells lining the gut to...urfaces in the gut they are more likely to stick a...r Nathalie Juge from the Institute of Food Researc...
(Date:11/24/2009)...mber 24, 2009) -- The Wildlife Conservation Societ...e last remaining population of Siberian tigers has...ide of poaching and habitat loss. , ...ials of what needs to be done to protect remaining... The report was released by the Siberian Ti...
(Date:11/24/2009)... Spanish . , The presence of increased body ...ubstances in the blood, hinders the loss and maint...ect of the University of Navarra conducted by Estb... Pharmacy. , The project, entitled "A nutrigenet...ol of body weight and inflammation," examines how ...
Breaking Biology News(10 mins):A sticky solution for identifying effective probiotics 2Report shows dramatic decline in Siberian tigers 2It can be predicted the reaction obese patients will have to a diet 2Shrinking Bylot Island glaciers tell story of climate change 9745 1Shrinking Bylot Island glaciers tell story of climate change 9745 2Shrinking Bylot Island glaciers tell story of climate change 9745 3Shrinking Bylot Island glaciers tell story of climate change 9745 4Kaiser Workers Statewide Campaign Starts Tuesday 55751 1Kaiser Workers Statewide Campaign Starts Tuesday 55751 2This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 1This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 2This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 3This Guys Got Blood and Heart At 320 and Counting Al Fischer Sets Record for Blood Donations 55747 4
(Date:11/24/2009)..., NEWYORK,Nov.24/PRNewswire-USNewswire/--Ther...oblems.Itisharmreduction,offeringpragmaticandreali...roblemshavefailed.Spearheadingthismovementisagroup...rationSupport.HAMSisafree-of-charge,lay-ledsupport..., TheNationalInstituteonAlcoholAbuseandAlcoholism...
(Date:11/24/2009)..., NEWYORK,Nov.24/PRNewswire/--TheGuardianLife...tmutuallifeinsurersandaleadingproviderofemployeebe...thatthecompanywillcontinuetofollowitscurrentinsura...eguidelinesareconsistentwiththeAmericanCancerSocie...sformammographyscreenings. ,, Recently,TheU.S.P...
(Date:11/24/2009)..., ChangesMustBeMadetoUSPSTFRepresentationand...ewswire-USNewswire/-- SeveralsectionsofSenatehealt...hatinsuranceentitiessuchasprivateinsurers,Medicare...vingaspecificgradefromtheU.S.PreventativeServicesT...icesforwomen40-49,wouldonlyrequirecoverageofbienni...
(Date:11/24/2009)... BEER-SHEVA, ISRAEL November 24, 2009 Researchers...ing a new device that detects cancerous skin tumor...naked eye. , During initial testing, the OSPI in...vealed new textures of lesions that have never bee... were diagnosed with various skin lesions and were...
(Date:11/24/2009)... INDIANAPOLIS Involving family members of pediatr...s benefits both the family and the medical team, a...icine study. , Riley Hospital for Children, whe...mall number of hospitals nationwide routinely offe...y patients the opportunity to join their child,s m...
Breaking Medicine News(10 mins):Health News:Harm Reduction for Alcohol: An Idea Whose Time Has Arrived 2Health News:USPSTF Mammography Recommendations Should Be Specifically Excluded From Health Care Reform Legislation 2Health News:USPSTF Mammography Recommendations Should Be Specifically Excluded From Health Care Reform Legislation 3Health News:New device enables early detection of cancerous skin tumors -- Ben Gurion U. 2Health News:Involving family in medical rounds benefits both family and medical team 2Health News:Involving family in medical rounds benefits both family and medical team 3Health News:Involving family in medical rounds benefits both family and medical team 4
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria