Navigation Links


Tag: "matter" at biology news

St. Jude study solves mystery of mammalian ears

...ration in hearing, which suggested that it did not matter whether the outer hair cells contracted or extended itself, that is, raised or lowered the cilia. There was no effect on amplification. The researchers concluded that somatic motility was not simply a way to make cilia do their job better; rather, th...

Nicotine rush hinges on sugar in neurons

...ally are filled with hydrophobic (water repellent) matter that helps the structure hold its shape, Chen said. The water molecule may enable the receptor to alter its shape in counterbalance to the bending hinge, said Chen, who explained, “Think of it as a lubricant.” Previously studied “homologs” of nAC...

Studies to find better ways to preserve human eggs, ovarian tissue under way

...to thaw rock-solid tissue at room temperature in a matter of seconds, meaning the current approach could have extremely limited use. A study he published in March 2000 in Nature Biotechnology showed the approach he uses works well, at least in blood vessels. “Now we want to try this on eggs and ovarian t...

Exploring the dark matter of the genome

...wn as heterochromatin was called "junk." Like dark matter in the universe, the true nature of heterochromati...erochromatin." Smith uses the metaphor of dark matter to suggest the significance of heterochromatin. "We don't know what holds the galaxies together, and...

Warning from Asian bees

...t that the arrival of destructor in Australia is a matter of when, not if, and its effects would be far more dramatic than a wide incursion of Apis cerana....

Technique monitors thousands of molecules simultaneously

... said. "But now for the first time it's not just a matter of structure, but rather a matter of location and scale ?a logistical problem." He offered the Great Wall of China as an example of ...

Brain's white matter -- More 'talkative' than once thought

...urprise that nerves in the mammalian brain’s white matter do more than just ferry information between differ...ions, but in fact process information the way gray matter cells do. The discovery in mouse cells, outlined in the cover story of the March issue of Nature Ne...

An ancient bathtub ring of mammoth fossils

...drain through to the Columbia River Gorge—all in a matter of days. Preliminary results place most mammoth finds in the Lake Lewis area at elevations of 600 to 1,000 feet, which echoes the distribution of boulders that originated from far away—so-called erratics—and rafted in on icebergs. The evidence sug...

Newborn neurons like to hang with the 'in' crowd

... young neurons that signal means survival. As a matter of fact, only about half of all newly born neurons manage to successfully integrate into the existing network of brain cells, at least in mice living in bare standard cages. Providing the mice with a stimulating, enriched environment—large cages fill...

New bacteria test could improve quality of fruit and vegetable juice

...t because it identifies the organism quickly ?in a matter of hours, unlike traditional culturing methods, which are time consuming and require five to seven days to process. Lin said that testing time is critical for juice processing companies, which monitor for the bacteria during the processing and final ...

Decoding protein structures helps illuminate cause of diabetes

...h into flat sheets, then coil into fibers. "No matter how fast they're moving, we can take pictures of them," says Zanni. Without their automated method, he says, such experiments would be nearly impossible. The technique also has potential application in other human diseases that involve protein mi...

Bats get the munchies too!

...l. “We think that this observation may be due to a matter of taste or flavour? explains researcher Francisco Sanchez, “The perception of sweetness versus bitterness may vary according the type of sugar and the amount of ethanol consumed. The combination of sucrose and ethanol may just have tasted better tha...

Researchers learn what sparks plant growth

...ations for commercial agriculture. "It’s been a matter of some debate for a very long time if one of these tissue layers controls plant growth or if all three layers have to work together," Chory said. "Our paper shows very clearly that the epidermis is in control—in both driving and restricting growth. ...

Nanotextured implant materials: blending in, not fighting back

...ugs or develop materials that will kill a cell ?no matter if it kills a bad cell or a good cell. We're trying to find materials that accept good cells, as opposed to killing off bad cells." Normal healthy blood vessels have a thin lining of specialized cells called the endothelium, surrounded by a thicke...

Bypassing eggs, flu vaccine grown in insect cells shows promise

... can be temperamental, and it’s not always an easy matter to get the virus to grow as you want in eggs.? The use of cell culture systems to grow vaccines ?using viruses as tiny factories to churn out mass amounts of vaccines ?is a growing business. A similar technology using human cell lines is used to pr...

Lithium builds gray matter in bipolar brains, UCLA study shows

...for bipolar disorder, increases the amount of gray matter in the brains of patients with the illness. The ...not on lithium, they found that the volume of gray matter in the brains of those on lithium was as much as 15 percent higher in areas that are critical for at...

Newborn brains grow vision and movement regions first

...s between neurons in different brain regions. Gray matter size grew by roughly 40 percent in the first months after birth, while white matter grew very little. "This pattern of brain growth in newborns has not been described before," said ...

Cold sore virus might play role in Alzheimer's disease

...he virus infiltrates brain cells about the same no matter which gene is involved. But they found that the subsequent activity level of the virus generally mirrored the disease-causing potential of the gene. They found that in animals with the ApoE-4 gene, the virus is less likely to be in the quiet, latent ...

Chemo combination improves survival in asbestos-related cancer

...nd information in the review. It is a personal matter as to whether the survival increase for patients receiving the two drugs is worthwhile, Baram said. "It depends in large part on the patient. A 2.8-month mean survival increase means that some patients may get even more than that, though some people ...

New study sheds light on 'dark states' in DNA

...ark energy state of DNA was a little like the dark matter in the universe ?there was no direct way of probing it. The Ohio State chemists used a technique called transient absorption, which is based on the idea that molecules absorb light at specific wavelengths, and allows them to study events happening in...

1 2 3 4 5 6 7 8 9

Other Tagsattached 2attached 3attached 4attached 5attached 6attached 7attached 8attached 9attached 10faces 2faces 3brought 2brought 3brought 4brought 5brought 6brought 7brought 8glial 2abnormal 2abnormal 3abnormal 4abnormal 5abnormal 6abnormal 7abnormal 8abnormal 9abnormal 10
(Date:12/3/2009)...reef fish can undergo a personality change in warm...gesting that climate change may make some species ...of young damselfish on Australia,s Great Barrier R...ish are either consistently timid, or consistently...ven more marked as water temperatures rise. , A ...
(Date:12/3/2009)... dwellers must be included in the design of the up... a humanitarian crisis, according to a scientist a...Nature , Dr Simon Lewis argues that at least 50% o...hagen, known as REDD (Reducing Emissions from Defo...st dwellers directly, and their property rights as...
(Date:12/3/2009)... leads the world when it comes to investment in en...ing and Physical Sciences Research Council (EPSRC)...needed: "Scientific and engineering research has a...ar power solutions, but more investment is needed ... if we are to meet our carbon emission targets by ...
Breaking Biology News(10 mins):Fish with attitude: Some like it hot 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Research is vital to a cleaner, greener, low carbon future 2Small optical force can budge nanoscale objects 14883 1Small optical force can budge nanoscale objects 14883 2MSC Appoints Linda Lane Senior VP Sales and Marketing 61578 1IEHP Ranks 232 in California Among Medicaid Health Plans 61573 1IEHP Ranks 232 in California Among Medicaid Health Plans 61573 2
(Date:12/4/2009)... The renowned Center for mind-body medi...g the only natural immuno-boosting herbal suppleme...rveda. , San Diego, Calif...nprecedented illness due to factors such as stress... millions of people around the world are looking f...
(Date:12/3/2009)... With a membership increase of more tha...ement not only as a milestone in its history, but ...ce. Most associations are experiencing a decline i...o;At a time when trade organizations across the na...experiencing unprecedented growth, signaling that ...
(Date:12/3/2009)...INNEAPOLIS, Dec. 3 Children,s Hosp...cipient of the 2009 Leapfrog Top Hospitals Award. ...ering care that is among the best in the nation wh...y. ,, The Leapfrog survey is the only national,...uding mortality rates for common procedures, infec...
(Date:12/3/2009)...EVERLY HILLS, Calif., Dec. 3 Chris...ivine Design Gala and Premier Shopping Event for P...at 50-70% off regular prices. The event kicks off...December 7, 2009, located at 9900 Wilshire Bouleva...rnia. Please visit www.divinedesign.org for mor...
(Date:12/3/2009)...erforms widely used sulfonylureas, but each patien...RSDAY, Dec. 3 (HealthDay News) -- A class of drug...abetes is associated with a higher risk of dying a...n, researchers say. , , Sulfonylureas, long a m... than metformin in a study of oral anti-diabetes d...
Breaking Medicine News(10 mins):Health News:The Chopra Center for Wellbeing Launches Vedamune: An Ayurvedic Supplement to Support The Immune System 2Health News:Florida Medical Association Marks Record Membership Growth 2Health News:Children's Hospitals and Clinics of Minnesota Receives National Recognition for Quality and Efficiency 2Health News:Christian Audigier Represented at Divine Design for Project Angel Food 2Health News:Diabetes Drugs Go Head-to-Head in Study 2Health News:Diabetes Drugs Go Head-to-Head in Study 3
Other Contentsmicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadachesmigrainesmigrainesmigrainesmiliamiliaria