Navigation Links


Tag: "look" at biology news

A first glimpse of the influenza replication machine

...have tried to understand the flu polymerase and to look for weak points that could be targeted by drugs," says Darren Hart, whose team participated in the research at EMBL Grenoble. "But no one could get enough protein to analyse its structure. We developed a way to use robots to screen tens of thousands ...

Ring-around-the-cell

...di points out that, from above, isolated podosomes look like a tent with rope-like lines radiating from a central pole. "In effect," she says, "the podosomes may be more than just seals. They appear to act as highly connected nodes of communication between the inside and outside of the cell, enabling the ...

Syphilis rate on rise in US gay, bisexual men

... few women become infected. The study does not look past 2003, but statistics suggest the trends continued through 2005, Heffelfinger said. There were 8,724 new cases of syphilis recorded in 2005. Khalil Ghanem, M.D., assistant professor of medicine at Johns Hopkins University School of Medicine,...

Coated nanoparticles solve sticky drug-delivery problem

...mucus barrier. Hanes and his colleagues decided to look for a chemical coating that might mimic the characteristics of a virus. "We found that the viruses that got through had surfaces that were attracted to water, and they had a net neutral electrical charge," said Samuel K. Lai, a Johns Hopkins chemi...

Dinosaur extinction didn't cause the rise of present-day mammals, claim researchers

...ly, scientists will be able to use the research to look into the future and identify species that will be at risk of extinction. The benefit to global conservation will be incalculable." ...

MIT's ocean model precisely mimics microbes' life cycles

...d Dutkiewicz plan to use this new type of model to look in more detail at what shapes the habitats of the phytoplankton and to link this to other, larger scientific issues about oceans, the plants and creatures living in them and global climate. "This is just the beginning," said Chisholm. "Now we ca...

NIH neuroscience microarray consortium launches high-throughput genotyping services

...ix platform and uses the Affymetrix exon arrays to look at splice variants, in addition to the new Illumina expression and genotyping capabilities. The principal investigator at Yale, Shrikant Mane, says that the "Illumina platform provides an important complement to the other technologies currently a...

UCLA: How does your brain respond when you think about gambling or taking risks?

...tivated when people take cocaine, eat chocolate or look at a beautiful face, Poldrack said. The researchers studied which parts of the brain became more active or less active as the amount of money participants could win or lose increased. Regions that become more active as the amount increases are con...

CSIRO imagery shows Outer Great Barrier Reef at risk from river plumes

... to parts of the reef scientists hadn't thought to look before." The images were taken from NASA's MODIS satellite by GeoScience Australia's Alice Springs site for a new product being developed by the Wealth from Oceans Flagship to track coastal and ocean events in real-time, building on the technology...

Genes and genius: Researchers confirm association between gene and intelligence

...le genetic markers throughout the gene. "If we look at a single marker, a DNA variation might influenc...ons of the gene." Dick says the next step is to look at the gene and its numerous variants to learn what is going on biologically that might affect cogni...

Chromosomal microarray analysis proves accurate

...chnology called chromosomal microarray analysis to look for potential genetic abnormalities in children, t...ally, he said, he hopes to develop tests that will look at greater areas of the genome. However, he said, there are many areas of the genome where all norma...

Cancer cells forming blood vessels send their copper to the edge

...or research. The X-rays allowed the researchers to look at the distribution of copper in both a cell model of angiogenesis and sections of breast tumor tissue rich in blood vessels. "We found that cells undergoing angiogenesis exhibit a distribution of their cellular copper that is distinctly different...

Research project tackles 'regeneration' gap

...an eye. In terms of brain diseases, scientists may look at ways to mobilize and reinforce the body’s own supply of adult stem cells to protect against or fight Alzheimer’s and Parkinson’s diseases, cancer, multiple sclerosis and traumatic injury. The project has received support from two private gifts ...

Dig deeper to find Martian life

...nditions on Mars, and shows that the best place to look for living cells is within the ice at Elysium, the...t life. This is the first study to take a thorough look at how radiation behaves in the atmosphere and below the surface and it’s very relevant to planned m...

Stress hormones may play new role in speeding up cancer growth

...ked colleagues for samples of actual NPC tumors to look for the presence of similar receptors. They studied tumor samples which included different types of NPC tumors. All had the sought-after receptors. "From this we can say that there is likelihood that all NPC tumors will have these receptors as wel...

ASU researchers test antibacterial effects of healing clays

...) Michael Crow has been promoting. A year ago, I'd look at the clay and say, 'well that's dirt.' Now I know a little something about clay structure; Lynda knows a little bit about microbiology. Alone, we each would have had to study for years; together we are partnering these disciplines with synergy that...

Key to zebrafish heart regeneration uncovered

...d by disease, the Duke scientists said. "If you look in nature, there are many examples of different types of organisms, such as axolotls, newts and zebrafish, that have an elevated ability to regenerate lost or damaged tissue," said Kenneth Poss, Ph.D., senior researcher for the team, which published ...

Plant studies reveal how, where seeds store iron

...nt." The findings reveal how essential it is to look beyond ferritin to understand how iron is stored by plants. The researchers say the stored iron in the vacuole is a key source of iron for developing seedlings. Seedlings that do not express the VIT1 protein grow poorly when iron is limited. In ad...

Proteins may predict lung transplant rejection

... patients treated years ago, the researchers could look for differences between patients who subsequently suffered chronic lung rejection and those who did not. The researchers combined proteomics (the study of proteins), the latest in mass spectrometry technology and the best analytical methods from t...

OHSU researchers demonstrate how white blood cells cannibalize virus-infected cells

...ng the body's immune system as to what diseases to look for. ...

1 2 3 4 5 6 7 8 9 10

Other Tagsavoidance 2avoidance 3torn 2suspected 2suspected 3suspected 4suspected 5suspected 6suspected 7suspected 8huge 2huge 3huge 4huge 5huge 6huge 7huge 8huge 9huge 10conventional 2conventional 3conventional 4conventional 5conventional 6conventional 7conventional 8conventional 9conventional 10suicide 2region 2region 3region 4region 5region 6region 7region 8region 9region 10
(Date:11/30/2009)...ratures continue to rise scientists are presented ...ecies respond and adapt. In a paper published in ...odriguez-Trelles and Dr Miguel Rodriguez assess th... of approximately 0.6˚C has already affected ...ng ecologists and evolutionary biologists is to pr...
(Date:11/30/2009)...report published in the December 2009 print issue ...lar type of control over their fertility that wome...sts have found how and where androgenic hormones w...on and male fertility. This opens a promising aven...discovery also offers hope to those who cannot hav...
(Date:11/26/2009)...r impressive antlers, red deer have been caught in... antlers are much more than decorative. They are l...ing. John Currey, from The University of York, UK,...f bone for over half a century and has become fasc...ugh a long-standing collaboration with Tomas Lande...
Breaking Biology News(10 mins):How can scientists measure evolutionary responses to climate change? 2Tough yet stiff deer antler is materials scientist's dream 2Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 1Deerfield Spa The Poconos Most Affordable Destination Spa Schedules Ribbon Cutting Event for Grand Opening of New Day Spa 51478 2Hologic to Present at the 29th Annual Canaccord Adams Global Growth Conference 51475 1Hush little baby Linking genes brain and behavior in children 9237 1Hush little baby Linking genes brain and behavior in children 9237 2
(Date:11/30/2009)...30 At a briefing of the...and the Consortium for Citizens with Disabilities ...ic Policy and Advocacy for NCOA, called on Congres...sponds to the growing crisis in long-term care for...ns of seniors, after working hard all their lives,...
(Date:11/30/2009)...mic is far from over. Every year, almost three mi...lion die from AIDS-related diseases." ,, WASHI... AIDS Day 2009 the Global AIDS Alliance (GAA) call...n two recent alarming reports from the World Healt...c continues to be of catastrophic proportion, affe...
(Date:11/30/2009)...g significant impact, CBO analysis understates the...ewswire/ -- The Blue Cross and Blue Shield Assoc...rding the estimate released today by the Congressi...irmed what many economists, actuaries, and health ...lthcare reform bill would make coverage more expen...
(Date:11/30/2009)...s equivalent to 113 chest X-rays, study finds , ... than half of patients who have abdominal/pelvic C...ts that expose them to extra radiation, U.S. resea...d pelvic series were performed on 500 patients age...30 to 50 years of age. The researchers concluded t...
(Date:11/30/2009)... 30 SEIU Local 21LA mem...ration Sodexo will hold a rally Tuesday, Dec. 1, 2...headquarters, 3800 Desire Parkway, New Orleans, to...y disciplinary policies that target employees who ...er. Sodexo employees who clean schools in the Reco...
Breaking Medicine News(10 mins):Health News:NCOA, Bedlin Brief Leading Aging Organizations on Health Care Reform, Needed Long-Term Care Provisions 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 2Health News:GAA Calls on President Obama to Act on the Reality of AIDS 3Health News:CBO Confirms That Premiums Will Increase Under the Senate Healthcare Reform Bill 2Health News:CT Scan Patients May Get Unnecessary Imaging 2Health News:As H1NI Hits New Orleans in Force: School Custodians to Hold Rally to Call on Contractor to Stop Penalizing Workers Coping With Illness 2
Other Contentsridgeridgemicrocephalymidwifemidwifeheadachesheadachesheadachesheadachesheadaches