Navigation Links


Tag: "hypothesis" at biology news

A new plant-bacterial symbiotic mechanism promising for crop applications

... plays the role of Nod factor, prompted the team’s hypothesis that a molecule similar to a plant hormone (4), cytokinin, could act in the mechanisms by triggering nodulation. The discovery of the nature of the signal molecule itself, which remains to be fully determined, brings a glimpse of future agricultural ...

Pregnant mom's exposure to flu vaccine kick-starts fetal immune system

...nd asthma) later in an infant’s life. However this hypothesis has remained controversial because of an inability to detect antigen-specific T cells in cord blood. Recently, a newly developed technique known as MHC tetramer staining has facilitated the detection of antigen-specific T cells. In the June 1 issue ...

1 2 3 4 5 6 7 8 9

Other Tagshormonal 2hormonal 3hormonal 4hormonal 5hormonal 6hormonal 7hormonal 8hormonal 9hormonal 10stars 2stars 3capture 2capture 3capture 4capture 5capture 6
(Date:11/24/2009)...4, 2009) New research on bacterial communities th... predictable temporal patterns, suggesting that sc...r monitoring climate change in the polar regions. ... of the National Academy of Sciences Early Editio...ers shifted synchronously over time, correlating w...
(Date:11/23/2009)...sents strong evidence that the "synergistic" effec...elated pollution and indoor endotoxin causes more ...osure alone. , Environmental health scientists...edicine have shown that children exposed to both h... endotoxin during early life are six times more li...
(Date:11/23/2009)...mber 23, 2009 Applied mathematicians dissected th...ia ), a characteristic long leaf with a saddle-lik...the edges. The simple cause of the lily,s fan-like...ring differential growthwas revealed by using an e..., Haiyi Liang, a postdoctoral student at Harvard...
Breaking Biology News(10 mins):Researchers establish common seasonal pattern among bacterial communities in Arctic rivers 2Exposure to both traffic, indoor pollutants puts some kids at higher risk for asthma later 2The cause behind the characteristic shape of a long leaf revealed 2Health Care Training a Great Option for Back to School Career Seekers 56327 1Health Care Training a Great Option for Back to School Career Seekers 56327 2Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 1Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 2Pew Commissioned Poll Finds Nine in Ten Iowa Voters Support More Government Oversight of Food 56323 3Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 1Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 2Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 3Hissey Kientz LLP Urges Patients To Heed FDA Warning About Phospho soda Products 56320 4
(Date:11/29/2009)...via,s Nanjing-based Service Delivery Center one of... Brno, Czech Republic (PRWEB) -- Mor...rovider, is pleased to announce its participation ...ld in Nanjing, China, on November 30, 2009. Moravi...panies that have established and grown a presence ...
(Date:11/29/2009)... Nov. 29 Acuo Technologies, develo...software, data migration tools and services, today... that allows image sharing across the networks of ...oShare solution is based on the versatile Acuo Tec...cuo AcuoShare enables secure access from various P...
(Date:11/29/2009)...itional healthcare,s uncertain future and rising c...ve care. Affordable Acupuncture Scottsdale answers...mber 29, 2009 -- Affordable Acupuncture, LLC opene...s been met with enthusiasm and gratitude. Its incr...ted to two things, need and cost. "As far as...
(Date:11/28/2009)...t spirits, recognize signs of depression , ...y seniors, the holiday season can trigger melancho...ith health issues or worry about money problems, a...To help overcome the seasonal blues, the AGS Found...ice: , Get out and socialize or invite family an...
(Date:11/27/2009)... 27 The Gymboree Corpora..., CFO/COO, will present at the NASDAQ OMX 23rd Inv...Hotel in London, England, on Wednesday, December 2...ve broadcast of The Gymboree Corporation,s present...oree.com, click on "Our Company" at the bottom of ...
Breaking Medicine News(10 mins):Health News:Moravia Worldwide to Participate in the 5th EU-China Business Summit 2009 in Nanjing China 2Health News:Acuo Technologies Announces a New Offering That Enables Sharing of Imaging Studies Securely and Affordably 2Health News:Affordable Acupuncture Greeted with Open Arms by Scottsdale and Phoenix Communities 2Health News:Seniors May Need Help Overcoming Holiday Blues 2
Other Contentschloroplastschloroplastschordateschordatejumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchyme