Navigation Links


Tag: "equipment" at biology news

Hope for major advance in fighting world killer disease

...t the correct antibiotics can be used. With basic equipment donated by the EACh-ChilD project, the test is now being piloted in four hospitals in south India, one of which, the Government Children's Hospital in Chennai, is the biggest children's hospital in Asia. Once any further improvements are made follo...

Fast test for low blood flow in dogs detects early heart trouble

...vessels can be readily detected by high-resolution equipment like 64-CT scanners. The device produces precise, 3-D, diagnostic pictures within five to 10 seconds by quickly passing X-rays through the body. The resulting digitized signals, called "slices" - and there are 64 - are then reconstructed by a co...

Supercomputing equipment to advance the frontiers of computational biology

...rful university-based supercomputing centers. The equipment will provide a resource for scientists to gain exp...ovations (CCNI). This $2.23 million gift of IBM equipment counts toward the $1.4 billion Renaissance at Rensselaer campaign. "This award further advances t...

Firefighters face increased risk for certain cancers

...ields. Their findings suggest that the protective equipment firefighters have used in the past didn't do a goo...tical and immediate need for additional protective equipment to help firefighters avoid inhalation and skin exposures to known and suspected occupational carcino...

With fruit fly sex, researchers find mind-body connection

... drastically reduced it. The result: Flies' sexual equipment was intact, but, theoretically, their sexual behavior might be different. McKeown and graduate student Troy Shirangi also reduced the activity of the fruitless gene as well as one called "retained." Shirangi and McKeown did, indeed, see a doublese...

Men with prostate cancer avoid radiation due to misconceptions

...rs felt that the technologically advanced computer equipment used during radiation treatment provoked anxiety. The study was carried out by a multidisciplinary team of doctors (urologists, radiation oncologists, medical oncologists and psychologists) at the Milan National Cancer Institute Prostate Cancer P...

New fMRI technology making brain tumor surgery safer

...any surgeries in the future. The new BrainLAB equipment also enables physicians to integrate diffusion tensor imaging (DTI), which provides a map of critical white-matter tracts in the brain. “White-matter tracts,?said Dr. Leach, “are like the electrical connections between different parts of a house. If ...

Monitoring poisons in the environment -- a woolly matter

...ations were then determined using highly sensitive equipment which can accurately detect very small quantities of heavy metals. This was compared with data from local streams for accuracy....

Scientists reveal structure of gateways to gene control

...on, made possible by recently developed laboratory equipment for high-volume, or massively parallel, DNA sequencing. "Traditional DNA sequencing methods processed one DNA strand at a time, but now we can sequence hundreds of thousands of DNA strands at once, rapidly learning incredible amounts of new informat...

Using dental X-rays to detect osteoporosis

...largely due to the cost and scarcity of specialist equipment and staff. The team has therefore developed an innovative software-based approach to detecting osteoporosis using routine dental x-rays, by automatically analyzing specific characteristics of the radiographic trabecular bone pattern. These features...

A new study of living cells could revolutionize the way we test drugs

...g electrons. It has given the team confidence that equipment sensitive enough to measure a cell’s heartbeat can be developed. "We already have some ideas about how to improve the sensitivity of the detector in water and next time we will also use a more active micro-organism such as an amoeba. Yeast is a su...

Study finds surfing safer than soccer

...d in the design of safer surfboards and protective equipment such as helmets," Nathanson adds. To reduce the...uate the effectiveness of modifications in surfing equipment on reducing the incidence of injury. ...

Cure for cancer one step closer

...ructure, a dedicated laboratory with highprecision equipment for preparation and study of tissue samples. This equipment includes an Aperio Scan Scope which takes high resolution images of tissue samples that can then be ...

Lighting up life: Cold Spring Harbor Protocols presents tips for creating glowing plants

...r maximal GFP detection, and setting up microscope equipment for imaging in plants. This information will be useful to a broad range of scientists interested in plant biology and imaging technologies. A second freely accessible article ( http://www.cshprotocols.org/cgi/content/full/2007/3/pdb.prot4674 )—a...

Bones in motion: Brown scientists to create new 3-D X-ray system

...l pay for the X-ray machines, treadmills and other equipment for a new CTX facility on campus. But creating the imaging technology will be a mainly computational challenge, so funding will also support substantial software development. Brown faculty and students are already at work on pilot projects to visu...

Cornell lab confirms deadly fish virus spreading to new species

... using infected bait minnows, contaminated fishing equipment or live water wells in boats, boating activities and ballast water. "Basically, we don’t know how it got here, but it is here and it’s spreading," said Bowser. "It would be wonderful if we did know. However, I don’t think we ever will." The Great...

Peanut allergies overstated, study finds

...Reasons for this may include variables such as the equipment used and the pressure administered by the practitioner during a skin prick test. "There is a population of children who have never eaten peanuts ?or worse, those that eat them everyday, then have a positive peanut skin test and are told not to eat...

From the deep -- Researchers find new species of sea anemone

...a tedious process that involves a lot of high-tech equipment like underwater video cameras attached to remotely operated vehicles (ROVs). Deep sea ROVs are also equipped with robotic arms and suction devices that are used to collect species. "It's like a submarine that's manned from the surface," said Daly,...

Diminishing dinosaur steps saved by laser and laptop

...artment in the UK can boast such equipment. The equipment is generally used in oil exploration, but this project is the first time The University has used it to create images of dinosaur tracks. Dr Manning has also extended the use of the scanner to palaeontological investigation in the Hell Creek Format...

How to steer a moving cell

...ts of its protein network. The cell fractionation equipment developed in Klemke’s lab is the first method to enable researchers to study the entire network of signaling proteins. "To find out what goes wrong during metastasis, we need to understand how the signaling networks are controlled in normal health...

1 2 3 4 5

Other Tagslocals 2formulate 2formulate 3ministers 2ministers 3ministers 4ministers 5ministers 6ministers 7nor 2nor 3nor 4nor 5nor 6nor 7nor 8nor 9nor 10neither 2neither 3neither 4neither 5neither 6neither 7neither 8neither 9connecting 2
(Date:12/3/2009)... Now in its 32nd year, the CTRC-AACR San ... in breast cancer science and world leaders from industry ... , This year, more than 8,500 scientists and ... Convention Center in San Antonio from Dec. 9-13, 2009. ...
(Date:12/3/2009)... must be included in the design of the upcoming forest ... according to a scientist at the University of Leeds. ... argues that at least 50% of the carbon credit payments ... from Deforestation and Degredation), should be made to forest dwellers ...
(Date:12/2/2009)... cigarette smoke have an increased risk of developing lung cancer ... of this study are published in Cancer Epidemiology, Biomarkers ... Cancer Research, as part of a special tobacco focus in ... 219,000 Americans will be diagnosed with lung cancer; more than ...
Breaking Biology News(10 mins):CTRC-AACR San Antonio Breast Cancer Symposium continues to expand 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Secondhand smoke exposure in childhood increases lung cancer risk later in life 2Cystic Fibrosis Foundation Receives Second 4 Star Rating from Charity Navigator for Exceptional Fiscal Management 54308 1Cystic Fibrosis Foundation Receives Second 4 Star Rating from Charity Navigator for Exceptional Fiscal Management 54308 2New Audio Podcast Provides an Insider 26apos 3Bs View of the Healthcare System 54307 1New Audio Podcast Provides an Insider 26apos 3Bs View of the Healthcare System 54307 2New Audio Podcast Provides an Insider 26apos 3Bs View of the Healthcare System 54307 3Fountain Healthy Aging Inc Announces 245 000 000 Equity Line Of Credit Investment Secured 54304 1Fountain Healthy Aging Inc Announces 245 000 000 Equity Line Of Credit Investment Secured 54304 2Fountain Healthy Aging Inc Announces 245 000 000 Equity Line Of Credit Investment Secured 54304 3
(Date:12/6/2009)... Internet Sleep Disorders information and Treatment site ... sleep problems with herbal or natural sleep aids ... ,insomnia remedies for a good cause. The submissions ... Natural Sleep Aids ,Encyclopedia, by YOU, to be ... The site will donate 100% of the proceeds ...
(Date:12/5/2009)... What: Cuts for a Cause ,, Why: ... and other terminal illnesses affecting children. All proceeds from each ... Research Hospital. Guests will enjoy complimentary beverages and hors d,oeuvres, ... in Falls Church for all guests. Hoa Lai, a DJ ...
(Date:12/5/2009)... wrong with being single, myth , , SATURDAY, Dec. 5 (HealthDay ... 40th birthday without ever tying the knot, since research has ... folks. And, um, isn,t there something wrong with those who ... new study looking at psychological measures shows that never-married people ...
(Date:12/4/2009)... ALTO, Calif., Dec. 4 Varian Medical Systems (NYSE: ... has set the regular 2010 Annual Meeting of Stockholders for ... 2009. The meeting will be held at the Crowne Plaza ... 4:30 p.m. PT. ,, The meeting will be webcast by ...
(Date:12/4/2009)... The American Association of Homes and Services for the ... Community Living and Supportive Services (CLASS) provisions remain in the ... for providing support to elders, people with disabilities and their ... health care reform bill that will make it affordable to ...
Breaking Medicine News(10 mins):Health News:Donate a Herbal Natural Sleep Aid to the Internet's First "Natural Sleep Aids E-book" Written by People Just Like You 2Health News:Never Married, Over 40, Well-Adjusted 2Health News:Never Married, Over 40, Well-Adjusted 3Health News:Varian Medical Systems Schedules Annual Stockholder Meeting in Palo Alto 2
Other Contentsjumpingjumpingjumpingjumpingwalkwalkwalkwalkwalkwalkwalkwalkchymecircularcircularcircularcircularcircularcircularcircularcircularcirculatorycirculatorycirculatorycirculatorycirculatorycirculatorycistroncladogenesis